KEGG   Saccharomyces cerevisiae (budding yeast): YFL004WHelp
Entry
YFL004W           CDS       T00005                                 

Gene name
VTC2, PHM1
Definition
(RefSeq) vacuolar transporter chaperone
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VTC DUF202 SPX MBOAT CPSase_L_D3 Pex14_N
Motif
Other DBs
NCBI-GeneID: 850544
NCBI-ProteinID: NP_116651
SGD: S000001890
UniProt: P43585
Structure
PDB: 

Position
VI:131810..134296
Genome map
AA seq 828 aa AA seqDB search
MLFGVKLANEVYPPWKGSYINYEGLKKFLKEDSVKDGSNDKKARWDDSDESKFVEELDKE
LEKVYGFQLKKYNNLMERLSHLEKQTDTEAAIKALDADAFQRVLEELLSESTELDNFKRL
NFTGFAKIVKKHDKLYPKYPSVKSLLEVRLKELPSHSEEYSPLLYRISFLYNILRSNFNT
ASEPLASASKFSSIVSNDIDMNFRSFKFWVHNDNLMEVKTRILRHLPVLVYANVPSENDD
LVNRFESDISNNDEIVGSSSSTSSVEHGLGARSFDPLINTLYFDNEHFELYNDKLLKLNS
APTLRLRWTGQLSDKPDIFLEKKTLIEDEATGKSEFDLTKLQLKQKFINGFIFEGDKKFK
EQTLKKLKESGTAGRDLERLEEDFSEIQNFIIKNELQPVFRTVYTRTAFQIPGDDKIRVT
IDSNIVFIKEDSFDRERPIRDPNTWHRTDIDANVANPLKFLRGGEYAKFPYSVMEIKVKS
SLDSSMSASSMISNVKLPKKHGQWLNDLTNSHLVKEIPKFSIFVQGVASLYGDDEKLDIL
PFWLPDLETDIRQDPKQAYEEEKKKLLKQKEIQKKIDGMRRLSNLKEPQHQAAVPVSQEE
NERITSQGDLEADGSSDEETEQEPHSKRSKKVRRRKPKATFLRILAGRDPKLMGVDSEEE
EIELPPGVKKPLNLLKNAGPVNVEAKVWLANERTFNRWLSVTSLLSVLTFSIYNSVKKAE
YPTLANYMAYVYFGLTIFCALWSYSIYMKRVDIIQQRSGQHLDAPLGPVLVSIVLFVTLV
VNFVMAFRNAAKSRQELQIQNLEVPERIPEVLRPLQNYLFKLMGPSSD
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttggagtgaagttggctaatgaggtttatcctccttggaagggttcttatatt
aattatgagggcttgaaaaaattcctgaaggaagatagcgtgaaggatggaagtaacgat
aagaaagcacgctgggacgattcagatgaatccaagtttgtggaagagttggataaggaa
cttgaaaaagtctatggttttcaactaaaaaagtacaataacttgatggagagattgtcc
catctggagaaacaaacagatacggaagcagccataaaggccttggacgctgatgcattc
caacgtgtattggaggaactgttaagcgagtctaccgaattagacaattttaagagattg
aactttactgggtttgctaagattgttaagaaacatgacaagctatatccaaagtatcca
tctgttaaatctttgttggaagttagattaaaggaattgccttcccattcggaagaatat
tccccattgttgtatcgtatttcatttttgtacaacattttgagaagtaattttaacact
gcatctgaacccttagccagcgcttctaagttttctagcattgtcagcaatgacatagac
atgaatttcagaagctttaaattttgggttcataatgacaacttaatggaggtcaaaaca
agaatcttgagacatcttcccgtgttggtctacgccaatgttccctccgaaaacgatgac
ctggtcaatagattcgaatcagatatatcaaataatgatgaaattgtgggtagttcgagc
tccactagtagcgtagaacatggcttgggagcgcgctccttcgatccattaatcaacacg
ctatattttgacaatgagcattttgaattatataacgacaagttattaaagttaaattca
gcacctactttaagattaaggtggactggccagttatctgataagccggatattttcttg
gaaaagaaaactcttattgaagacgaagccactgggaagtctgaatttgatctaactaaa
ttgcaattgaaacaaaaattcattaacgggtttattttcgaaggtgataagaaatttaaa
gaacaaactttgaaaaagttaaaagaaagtggtacggcagggagagacctggaaaggtta
gaagaagatttctctgagattcaaaactttattatcaagaatgaattgcaaccagttttt
agaactgtttacaccagaactgctttccagattcccggcgatgacaagataagagtaacc
attgactctaatattgtattcatcaaggaggattcattcgacagagagcgtccaattaga
gaccctaatacctggcatagaactgatattgatgccaatgttgcaaatcccttgaaattc
ctgagaggaggcgagtatgctaagtttccttattcagtaatggaaattaaagtgaaaagt
tcattagattcttcgatgtctgccagttctatgatttctaatgtaaaactgcctaaaaag
catggtcaatggctgaacgatttgacaaattctcatttggtcaaagaaattccaaagttt
tctatctttgtgcaaggtgtggcatcattgtatggagatgatgaaaaattagatatctta
ccattttggttaccagatttggaaacagatattagacaggatcctaagcaagcatatgag
gaggaaaagaaaaaactgttgaaacaaaaagagatacaaaagaaaattgatggaatgaga
aggctttccaacttaaaagagcctcaacatcaagcagcagtaccggtatctcaagaggaa
aatgagcgtattacctctcaaggtgatttggaggcagacggttcatccgatgaggaaact
gagcaagaacctcattcgaaaagatcaaagaaagttcggagaagaaaacccaaggccact
ttcttgagaattttggccggtagagatccaaagttaatgggggtggattctgaagaagaa
gaaattgaattgccacctggtgtgaaaaaaccattaaatttgttaaaaaatgctggtcct
gtaaacgtggaggcaaaggtttggcttgccaacgaacgtacatttaacagatggttaagt
gtcaccagtttattgagtgttttgacgttctcaatttataattctgtgaagaaagccgaa
taccccactttggctaactacatggcatacgtatattttggtctaacgatattctgtgct
ttatggtcctattccatttatatgaaaagagttgatattattcaacaaagaagcggtcaa
catctagatgcaccacttggtccagttttggtttctatagttttatttgtcactttagtg
gttaattttgttatggcgtttagaaatgcagcaaagtctcgtcaagagttgcaaatacag
aatttagaagttcctgaaagaataccagaagtattaaggccacttcaaaattatctattc
aagttaatggggccaagcagtgattag

DBGET integrated database retrieval system