KEGG   Saccharomyces cerevisiae (budding yeast): YFL007WHelp
Entry
YFL007W           CDS       T00005                                 

Gene name
BLM10, YFL006W
Definition
(RefSeq) Blm10p
  KO
K06699  proteasome activator subunit 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    YFL007W (BLM10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YFL007W (BLM10)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Regulatory particles
   PA200
    YFL007W (BLM10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BLM10_mid BLM10_N DUF3437
Motif
Other DBs
NCBI-GeneID: 850541
NCBI-ProteinID: NP_116648
SGD: S000001887
UniProt: P43583
Position
VI:123479..129910
Genome map
AA seq 2143 aa AA seqDB search
MTANNDDDIKSPIPITNKTLSQLKRFERSPGRPSSSQGEIKRKKSRLYAADGRPHSPLRA
RSATPTLQDQKLFNGMDSTSLLNERLQHYTLDYVSDRAQHMKNIYDPSSRWFSRSVRPEF
PIEEFLPYKTESHEDQAKYLCHVLVNLYIAISSLDIQGLISISSKDLADLKKEVDDLALK
TDLFRLSNNTAENDLLGNDIADYDDAEGLEDELDEYFDLAGPDFNATGKITAKSATIVNV
NHWTNELKNCLHFDFPVALRKSLATVYYYLSLVQGQKVYRQMHVDMFERLVSLDDDRTNF
TELLQKQGLLLDHQIMLNFLCEFLPYPDPDYARYELSSKEDLQLFRLLLKHAHNAKPFFD
KSKESLLVDTMNFLLSSLAPSTMMAVMPIVTSVVPYHYHIHSKIIDYFPFCYSIWSSVSA
NVAIDTHMYDFVGSISKDVHNKILSSEHEKDVVGVEFGEFGIFTDDQMTFMFNRLQGHLR
TDGQIHSYSRTVKPFVYAINGSKKDRFFEKLVSLAKAIETFIHPSNNGFWTKPNAKFVHA
FIKSYHGRVKYEEDICARGVTNGICLTSFCHEEIVEIFLNIISLGSQNKNPDIANYYISC
FAYLLELDPSNAYLIYDKILIDLYDTLADQFINSRHRIISSLKQFTRVIRFIVMDKLYRV
HITNVLSMLVSKLDMNDTNLTSNLINGIVSIAAFIPIQDLTGEDDYISFESDTLPLVQQH
FYHIKCGESSKTFRVDDELLNNAFKASTTVFQSMLKVYVEKIFQLVDVDLEDSLVTKINQ
TTMILQESMDDKIFNYFASLLQRNFWSNDSFKEKDPNYELVTIPLAALVRRNNGLSKELV
RTLLFHIKEQIKRGAGSVRSTSEIQQRDVKLVLYLTALNDVLRQCHESLLEYSDELITFM
KYLYDNVTNPPLDVITSIVIHSALATLCTTEITDCRLFPEDSKIPEKDRWGGLQFDPRRF
DKQHLSFQWHVPSSDEITLSISILESLSEYCINNVEELMKAPRHDSEYGDMIQKYVLVMT
HTLSGSSLLFDPDFNKYRTQSNLSYREKLILLKNIRENNCDPQELDIDIEQIRSGKDDED
YIESKDIEAGLNAGVSDVVQLRDEFPDELIVDEEVVSEMPSGVNTPIAGTHGTDNSAMSS
DLAFRDLDIYTCNYYFGNTTEEKLQNPQYLQVHRVRARIGHFFHKLYVFLSTNFENNTNM
FQILLHGLKVWFTDLGQETVFNEDPNAFIDVDFLENVQSLSHVNEPFTRTNFAIRANSLH
QSRVLLHSTNRKASKLENLLLVDIIQLATSLYPDIYKPAQGTLVHCMKQLVGSYGVVINK
IIPSLEKAIKDHDYMKIQVILNVLLIKKIHRKLMTDYKDIGRLIFLLIECCRVNELEIGM
YADKILTDIVIGIKIPSSVCVISDQAFLPLAPPDGTINLQVEAVKLAKKKKREYYLSLLV
DLQDKLLDKLDNEKDMGWKIRMFILRFVTQIQSNLESKPDKRAVFSIISQISTKHPEIIH
LVVKSLLSTCNKIISLSDYEYDITRAYKNEFNPSFVEILDTSTTSFPKTFTEEMNNFDNP
KYFIDLRAYVGWLCWGRLMYVMSPKALKLNLRENELEVLKTAGHLLTREFLRDVTMNLVQ
DNETRGVFSSGNVSFFSLVILLISSGFCELNMSDLFELCESYYNKDDKASMIMSVEIVAG
LVCGSKFMSVSDLDKRDTFIENFLAKCLDYELNHDAFEIWSTLAWWLPAVVDLRRSKTFF
CHFINADGMFDRESDAATHQTSKIYMLRSILMSMEFRAPDVGKLFDELVFDHPYDQVRQA
VAKLLTTLVQNQSNPSISDPTTLLEAERNDPDGLGLPLKSVPEKVDAYIKKQFEIIKNLE
DSVVGLNPQQFIKTDYFYRTSTIFYWIKEMARGPNKVLLVPYLVDYVLPFLIGLVKHKDV
CALASLDPVRLYAGLGYMPIRKNHVAAIVDYVCSSNVALSSNQTKLQLAFIQHFLSAELL
QLTEEEKNKILEFVVSNLYNEQFVEVRVRAASILSDIVHNWKEEQPLLSLIERFAKGLDV
NKYTSKERQKLSKTDIKIHGNVLGLGAIISAFPYVFPLPPWIPKQLSNLSSWARTSGMTG
QAAKNTISEFKKVRADTWKFDRASFNTEELEDLEGVLWRSYYA
NT seq 6432 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctaacaatgacgatgatatcaaatcacccattcccattactaacaagacctta
tcccaattgaagcgctttgagagaagtccaggaaggcccagttcttctcagggcgagata
aaacgtaaaaagtctaggctatatgccgcagacggaagaccacattctccgctaagagca
aggtctgctaccccaacgctacaggaccaaaaactgttcaatggcatggattccacttcc
cttttgaatgaaaggctacagcattatacgctggattatgttagtgacagggcccagcat
atgaagaatatatatgacccatcatctcgctggttcagcagatccgtgaggcctgaattt
cctattgaagagttcttaccatataagactgaaagtcatgaagatcaagcgaaatacttg
tgccatgtcttagttaatctttatattgcgatcagctcattagatatacaaggtttgatt
tctatttccagtaaagatctggctgatttaaagaaagaagtggatgatttagctcttaaa
accgatcttttcaggttatctaacaacacagcggagaatgacttacttggtaacgatatt
gctgattatgacgatgcggaaggcctggaggacgaattggatgaatacttcgacttagca
ggccccgactttaatgctaccggaaaaatcacagctaaatcagctactattgtgaatgta
aaccattggactaatgagctcaaaaattgtctacattttgattttccagtagctttaaga
aagtcgctagcgacagtttattattatttgtctcttgttcagggccaaaaggtgtataga
caaatgcatgtcgatatgttcgaaagattagtaagccttgacgatgataggacaaatttc
actgaactgttgcaaaaacaaggtcttttgctagatcatcaaatcatgctcaatttcctg
tgcgaatttctaccttatccagatcccgactatgctcgttatgaattatcatcaaaggaa
gatttacagttatttagattacttttgaagcatgcacataatgcaaaaccatttttcgat
aagtcaaaggaaagtttgttagttgatacgatgaattttctgttgtctagtcttgcacca
tctactatgatggctgtcatgcctatcgttacatccgttgtgccctatcattatcatatc
cattctaagatcatcgattatttcccgttttgctatagcatctggagctcagtcagcgca
aacgtggccatcgacactcacatgtatgattttgttgggtcaatttccaaagacgttcat
aataagattttgagtagcgagcatgaaaaggatgtagttggagtggagtttggagaattc
gggatttttactgatgatcaaatgacttttatgttcaataggttacaaggccatcttaga
acagacggtcaaatacattcgtattcccgcacagtgaagccttttgtttatgctataaac
ggatcaaaaaaagataggttttttgaaaaacttgtaagtttagccaaagcaatcgaaaca
tttatccatccctctaataatgggttttggaccaagccaaatgctaaattcgttcatgca
tttataaagtcttaccacggaagggtcaaatatgaagaagatatttgtgctaggggcgtc
acaaatgggatatgtttaacttctttttgtcacgaagagatagttgaaatattcttaaat
attatcagtctgggttcacagaataaaaatcctgatattgcgaactattacatctcttgt
ttcgcatatctgttagagctggatccttcaaatgcatatttaatttatgacaaaatactg
atagatttgtacgatacgctggctgaccaatttatcaattcgagacacagaatcatttcc
tctttgaaacaatttacaagagtaattcggtttattgtgatggataagctatatcgcgtg
cacataacaaacgtcctttcgatgctggtctccaaacttgatatgaacgatactaatttg
acaagcaacctcatcaacggtattgtatctatagccgctttcattcctatccaagacctc
actggggaggacgattatatatcgtttgaatcggatactcttcctttagttcaacaacat
ttttatcatattaagtgtggcgaaagttcaaagaccttccgagttgatgatgaactgtta
aataacgctttcaaagcttccactacagtttttcaaagtatgctaaaagtatacgtagaa
aaaattttccaattggttgatgtagacttagaggactctttggttactaaaataaaccaa
acaactatgattttacaagagtctatggacgataaaatatttaattattttgcttcttta
ttacagagaaacttctggagtaatgactccttcaaggaaaaggatccaaactatgaatta
gttactatcccactagcggctttagtaagaaggaataatggtttgagtaaagagttggtc
agaactcttttattccatatcaaagaacaaatcaaaagaggcgccgggtctgtaagaagt
acttcagagattcaacagagggatgttaagttagttttatacttaactgcactaaatgat
gtcttaaggcaatgtcatgaatctctattggagtatagcgatgagttgataacattcatg
aaatatttatacgacaacgtcactaacccgccattggatgttatcacatctattgttatt
cacagtgctttagcaactctatgtacaaccgaaataactgattgtcgtctattcccagag
gactctaagattccggaaaaagacagatggggaggactacagttcgatcctcgaagattt
gataaacagcatttgagttttcagtggcacgtaccttctagtgacgagataactttatcc
ataagcattctagaaagcctttccgaatactgtattaacaacgtagaagaactgatgaaa
gctccaagacatgattccgaatatggcgatatgatacaaaaatatgttttagttatgaca
catacgctttccgggtcaagtttactttttgatccagattttaacaaatataggacgcaa
tcaaacttatcatacagagagaaactgattttattaaagaatatacgcgaaaataattgt
gaccctcaagaactggatattgatattgaacaaattcgttctggcaaggatgatgaagac
tatattgagagtaaggacattgaagcagggctgaatgcaggagtttccgatgttgtgcag
ttaagagatgagtttccggatgaattaattgttgatgaagaagtagtgtctgagatgcca
tctggtgtaaatacccctatcgcggggacgcatggcacggacaattcagctatgagttcg
gatctagctttcagggatttagatatttacacctgtaattattacttcggaaataccact
gaggagaagttacaaaacccacaatatttacaagtccacagagttagagcgcgcattgga
catttctttcacaaactctatgtttttttatctacaaacttcgaaaacaacaccaacatg
ttccaaattctattgcacggattgaaagtttggttcacagatctgggacaagaaacggtc
ttcaatgaagacccaaatgccttcattgacgttgatttcctagaaaacgttcaatctctc
tcacacgtaaatgagcccttcacgagaaccaattttgcaatcagagcaaacagtttgcac
cagagtagagttctattacattcaacaaatagaaaagcttccaagctggaaaacctattg
ttagttgacatcatacagttagcgacatccctttatcctgatatttataaaccagcacag
ggaactttggtacactgtatgaaacaattagttgggtcatatggcgtagtcatcaataaa
attattccatcattagagaaagcgattaaggatcatgattatatgaaaatccaagttatt
ttaaatgttttgttaattaagaaaatccataggaagcttatgacggattataaagacatc
ggcagattgatatttctgcttattgaatgttgtcgtgtgaatgaattagagattggtatg
tatgcagataaaatcttaactgacatagtgattgggatcaagattccttctagtgtatgt
gtcatttccgatcaagctttcttacctttagcacctcctgatggtactattaatttgcaa
gttgaagcggtaaagcttgccaaaaagaaaaagcgtgagtactacctctctctgttagtg
gatttgcaggacaaacttttagacaaattagataatgaaaaagatatggggtggaagata
agaatgttcattttacgttttgttacacaaatccaatcgaacctcgaaagcaaacccgat
aaaagagcagtattttcaataatctcccaaatctccacaaaacatcccgaaatcatacat
ttggttgtaaagtcattgttgtcgacgtgcaacaagataatatctctctctgactatgaa
tatgacatcaccagggcctataagaatgaattcaatccatcatttgtggaaatactggac
acttcgaccacaagcttccctaaaacgtttactgaagaaatgaataactttgataacccc
aagtattttatcgatttgagggcgtatgtagggtggctatgttggggaaggcttatgtac
gtcatgtcgccgaaagctttaaagctcaatttacgtgagaatgaactggaagtcctcaag
acagctggtcatctattgacaagagaattcctgagagatgttacaatgaatttagtccaa
gataatgaaactaggggtgtttttagtagtggtaacgtgtcatttttctctttagtaatc
cttttgatatcatctggtttctgcgaactgaatatgtcggatctctttgagctatgtgaa
tcctactataacaaagacgataaggcttcgatgatcatgtctgtcgagatagtggctggc
ttagtttgcgggagtaagtttatgtcagtctctgacttggacaaacgtgacacttttatc
gaaaacttcctagccaaatgtttagattatgagttgaaccatgacgcatttgaaatttgg
agcaccttggcatggtggttgcctgcagtcgttgatttaagaaggtctaaaacttttttt
tgccattttatcaacgccgatggcatgtttgaccgtgaatctgatgcagccacacatcaa
acctccaaaatttacatgctaagaagtatcttgatgagcatggaatttagagccccagat
gttggtaagctatttgatgagttggtatttgatcacccatacgatcaggttcgccaggct
gtcgctaaactattgacgaccttagttcaaaatcaaagtaatccgtcaatttcagatcca
accacattattagaagcagaacggaatgatccagatggattagggttaccattaaaaagc
gtcccagaaaaggtggatgcctatattaagaagcagtttgagatcattaaaaatctggaa
gattccgttgtcggcctgaatcctcaacaatttattaagacagactatttttacaggaca
tccacaatattttattggatcaaagaaatggcgagagggcctaataaagttttgttagtt
ccatatttagtcgattatgttttaccatttctgatcggattagtgaaacataaagatgtt
tgtgctcttgccagtttagatcctgttcgattgtatgccggcttgggctatatgccgatc
agaaagaaccatgttgccgccattgttgactatgtttgttcgtcaaatgtagcactatct
tcaaaccaaacgaaactacagctagctttcatccaacactttttatcagcggaactgctt
caacttactgaggaagaaaagaacaaaattttggaatttgttgtcagcaatttgtataac
gaacagtttgtagaggtgagagttcgtgcggcatccattttgtctgatatcgtccataac
tggaaagaggaacagccgttgttgagtttaatcgagagatttgcaaagggtctcgacgtc
aacaaatacacgtcgaaagaaagacaaaagttatccaaaacggatatcaagattcatggt
aacgttttgggtttgggagctattatatcagcgttcccctatgtttttcccctaccgcca
tggatacccaagcaactaagcaacttatcctcgtgggccaggactagtggtatgactgga
caagctgccaaaaatactattagtgagttcaagaaggtgagggccgacacttggaagttc
gatagagcatctttcaatacggaggaactggaagacctggagggtgtcctatggagaagt
tactatgcctga

DBGET integrated database retrieval system