KEGG   Saccharomyces cerevisiae (budding yeast): YFL010CHelp
Entry
YFL010C           CDS       T00005                                 

Gene name
WWM1
Definition
(RefSeq) Wwm1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WW
Motif
Other DBs
NCBI-GeneID: 850538
NCBI-ProteinID: NP_570898
SGD: S000001884
UniProt: P43582
Position
VI:complement(115108..115743)
Genome map
AA seq 211 aa AA seqDB search
MAQSKSNPPQVPSGWKAVFDDEYQTWYYVDLSTNSSQWEPPRGTTWPRPKGPPPGVNNEK
SSRQQADQAPPPYSSQSTPQVQAGAQAQQPRYYQPQQPQYPQYPQQQRYYPQQAPMPAAA
PQQAYYGTAPSTSKGSGHGGAMMGGLLGVGAGLLGGAMLEHAFDDHNYDGPDTVVVENNY
YGDDAGGSDGGFDDAGGFDGGFDDGFDGSDF
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagtaaaagtaatcctcctcaagtgccttctggctggaaggctgtttttgat
gatgaataccagacttggtattatgtagatttatctacgaacagctctcagtgggaacca
ccaaggggaacaacatggccaagacccaaaggtcctccaccaggtgttaacaatgagaag
agttctcgtcaacaggcagaccaggctcctccaccttattcttctcaatcaacaccgcaa
gtgcaagcaggggcccaagcacagcaacctcgttactatcagcctcaacagcctcagtac
cctcaataccctcaacagcagcgttactatcctcaacaagcccctatgccagcagcagca
ccacagcaagcatactatggaactgcgccaagcaccagtaaaggtagtggacacggcggt
gccatgatgggtggtttacttggtgttggtgcgggtttgttaggtggagctatgctagaa
cacgcatttgacgaccacaactatgacggaccagacactgtcgttgtcgagaacaattac
tacggtgatgatgctggtgggtccgacggcggatttgatgatgctggtgggttcgacggc
ggatttgatgatggatttgacggtagtgacttttaa

DBGET integrated database retrieval system