KEGG   Saccharomyces cerevisiae (budding yeast): YFL013CHelp
Entry
YFL013C           CDS       T00005                                 

Gene name
IES1
Definition
(RefSeq) Ies1p
  KO
K11675  Ino eighty subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YFL013C (IES1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   INO80 complex (yeast)
    YFL013C (IES1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 850534
NCBI-ProteinID: NP_116641
SGD: S000001881
UniProt: P43579
Position
VI:complement(107852..109930)
Genome map
AA seq 692 aa AA seqDB search
MGKRVYDPIHDTFQLREDNSDETKADSPMQSVKSGSQEEASPSSIQSETETVTTKSIPVI
HEIEIDDKNDDDSTQSEEENTNILLNFEPSTVPEATGASTATGPVTTNTVRRKPKESNAS
KYNRHLKKPDGEPFNRKDIQFSFMQELLMDKRQIFTNVLKPLYKNSIVPINIDGDKLSIN
VTDKEYDARTFVFNDKLTFAQLYVLTIATSIKCSKILRDKLLLDQQVAFSTCVLALLVNI
GRLNTTINFYLEMTSQLRTFHSVPVLQLHANDPKLLQDTPRLKSILKNLPWGNEQLSLME
TYKKVDQNDGEVDTVNKFNIINMLFSICDNSGLIDKRFLSKYVEVESKAQEQDMVDEQNE
VKETEAENEKQESKAAYATTLFDILDYSKYEPKDRSNILIWLLYIHLETNLSQEEVEESV
RFFNGLEDGAPAGKFILRCTERSYDTDPEDELEFGANQRIKRREFMSKMEEGRKRERTNV
TEVKKPSIGGDKSEEDGEGEDDKSEETVEETRSLLTPTPILESSSPMTLNRKKVTPQLPK
VTPAAPTETEEEITSAAIIDKNDLNLTPLKKYNSSATVNKVDKLISLDLNKHVSENGKTQ
EEFLADLKKSQVPNRLKRRDIGLIKIFNEFEDIPVASVLGIRGKKRKKFKDNLLGFETDF
MKNLGASKKVLLNKIERAEIDDEEATAMFKLE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggggaagagagtatacgatccaattcatgatactttccaactacgagaagacaattct
gacgaaacaaaagcagattctccaatgcaatctgtaaaatcgggatcacaagaagaagca
tccccaagctccattcaatcagagaccgagactgtgactacaaaaagcattccagttata
cacgagattgaaatcgacgataaaaatgatgatgactccacgcaaagtgaagaagaaaat
accaacatcttgctcaacttcgaaccttctacagtgcctgaagcaacaggagcaagtacg
gcaacggggccagtgacaactaacactgttagaaggaaacccaaagaaagcaatgccagt
aaatacaatcgtcatttgaagaaacctgacggcgagccattcaatagaaaggacattcag
ttcagtttcatgcaagaactgttgatggacaagaggcaaatcttcactaatgttctaaaa
cccctatacaagaactctattgtacccattaatatcgatggcgataaattatcaatcaac
gtgaccgacaaagagtacgatgcaaggacatttgtatttaacgataaattgacgttcgca
caattgtatgtgttgacaatagccacttctatcaaatgttccaaaattctcagagataaa
ctattattagaccaacaagtagcattttctacttgtgttttagcgttattggtcaacatt
ggtaggttgaacaccactataaatttttatttagaaatgacatcgcaattgagaactttt
cactccgtgccagttttacaattacatgccaatgatccgaaacttttgcaggatacacct
agactgaaatctattctgaaaaatctgccgtggggcaatgagcaactctcattgatggag
acttacaaaaaggtcgaccaaaatgatggtgaagtggacaccgttaacaaatttaacatt
attaatatgttgtttagcatatgtgataattccggcctaattgacaagaggtttctttcc
aagtatgtggaagtcgaatcgaaagctcaggagcaagatatggtagatgaacagaatgaa
gtaaaagaaacggaagcggaaaatgaaaaacaagaatcaaaagcagcttatgcaacaaca
ttatttgatatactggactattcgaaatacgagccaaaggatagatcaaacatattgatt
tggctgctatatattcatttggagacaaacttaagccaggaggaggtcgaagaatcagta
agatttttcaatggattggaagatggtgcacctgctggaaagttcattttaaggtgtacg
gaacgcagttacgacacggatcctgaagatgaattagagttcggagccaaccaacgcatc
aagagaagagaattcatgagtaagatggaggagggtaggaagcgcgagcgtaccaatgtt
acagaggtgaaaaagcccagtatcggtggtgacaagagtgaagaggacggtgaaggggaa
gatgacaagagcgaggagactgtagaggagactagatcacttttgacgcctacgcccata
ctggaatcttcttcacccatgacattgaacaggaaaaaagtcacaccacaactgcccaaa
gtaacgccagcagcaccaacagaaacagaagaagaaatcacctccgctgctatcattgac
aaaaacgatttaaatctaacaccattgaaaaaatacaatagttcggctacggtaaacaag
gtcgacaagctaatatcgctagatctgaacaagcatgtgtcagaaaatggtaagacacaa
gaggagtttctcgccgatttgaaaaaatcccaggtgccaaacaggttgaaaagacgcgat
attgggttaatcaagatattcaatgaatttgaagacatccccgtagcgtcagtgcttggg
attcgcggtaaaaagagaaagaaattcaaagataatttgcttggatttgagacggatttc
atgaaaaatctcggcgcttcaaagaaagtacttttaaataaaatcgaacgcgcggaaatt
gatgacgaagaagcaaccgccatgtttaagctggagtga

DBGET integrated database retrieval system