KEGG   Saccharomyces cerevisiae (budding yeast): YFL014WHelp
Entry
YFL014W           CDS       T00005                                 

Gene name
HSP12, GLP1, HOR5
Definition
(RefSeq) lipid-binding protein HSP12
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP9_HSP12 DUF357 DUF883
Motif
Other DBs
NCBI-GeneID: 850532
NCBI-ProteinID: NP_116640
SGD: S000001880
UniProt: P22943
Structure
PDB: 

Position
VI:107256..107585
Genome map
AA seq 109 aa AA seqDB search
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSA
EKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgcaggtagaaaaggattcggtgaaaaagcttctgaagctttgaagccagac
tctcaaaagtcatacgctgaacaaggtaaggaatacatcactgacaaggccgacaaggtc
gctggtaaggttcaaccagaagacaacaagggtgtcttccaaggtgtccacgactctgcc
gaaaaaggcaaggataacgctgaaggtcaaggtgaatctttggcagaccaagctagagat
tacatgggagccgccaagtccaagttgaacgatgccgtcgaatatgtttccggtcgtgtc
cacggtgaagaagacccaaccaagaagtaa

DBGET integrated database retrieval system