KEGG   Saccharomyces cerevisiae (budding yeast): YFL018CHelp
Entry
YFL018C           CDS       T00005                                 

Gene name
LPD1, HPD1
Definition
(RefSeq) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00020  Citrate cycle (TCA cycle)
sce00260  Glycine, serine and threonine metabolism
sce00280  Valine, leucine and isoleucine degradation
sce00310  Lysine degradation
sce00380  Tryptophan metabolism
sce00620  Pyruvate metabolism
sce00630  Glyoxylate and dicarboxylate metabolism
sce00640  Propanoate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YFL018C (LPD1)
   00020 Citrate cycle (TCA cycle)
    YFL018C (LPD1)
   00620 Pyruvate metabolism
    YFL018C (LPD1)
   00630 Glyoxylate and dicarboxylate metabolism
    YFL018C (LPD1)
   00640 Propanoate metabolism
    YFL018C (LPD1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YFL018C (LPD1)
   00280 Valine, leucine and isoleucine degradation
    YFL018C (LPD1)
   00310 Lysine degradation
    YFL018C (LPD1)
   00380 Tryptophan metabolism
    YFL018C (LPD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YFL018C (LPD1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     YFL018C (LPD1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YFL018C (LPD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox NAD_binding_8 FAD_oxidored GIDA HI0933_like Pyr_redox_3 AlaDh_PNT_C FAD_binding_2 FAD_binding_3 Thi4 DAO K_oxygenase 3HCDH_N THF_DHG_CYH_C Trp_halogenase Lycopene_cycl UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 850527
NCBI-ProteinID: NP_116635
SGD: S000001876
UniProt: P09624
Structure
PDB: 

Position
VI:complement(101628..103127)
Genome map
AA seq 499 aa AA seqDB search
MLRIRSLLNNKRAFSSTVRTLTINKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGK
LGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLT
GGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGSEVTP
FPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIG
ASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVL
LVAVGRRPYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEE
GIAAVEMLKTGHGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRA
KTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPT
LSEAFKEANMAAYDKAIHC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaatcagatcactcctaaataataagcgtgccttttcgtccacagtcaggaca
ttgaccattaacaagtcacatgatgtagtcatcatcggtggtggccctgctggttacgtg
gctgctatcaaagctgctcaattgggatttaacactgcatgtgtagaaaaaagaggcaaa
ttaggcggtacctgtcttaacgttggatgtatcccctccaaagcacttctaaataattct
catttattccaccaaatgcatacggaagcgcaaaagagaggtattgacgtcaacggtgat
atcaaaattaacgtagcaaacttccaaaaggctaaggatgacgctgttaagcaattaact
ggaggtattgagcttctgttcaagaaaaataaggtcacctattataaaggtaatggttca
ttcgaagacgaaacgaagatcagagtaactcccgttgatgggttggaaggcactgtcaag
gaagaccacatactagatgttaagaacatcatagtcgccacgggctctgaagttacaccc
ttccccggtattgaaatagatgaggaaaaaattgtctcttcaacaggtgctctttcgtta
aaggaaattcccaaaagattaaccatcattggtggaggaatcatcggattggaaatgggt
tcagtttactctagattaggctccaaggttactgtagtagaatttcaacctcaaattggt
gcatctatggacggcgaggttgccaaagccacccaaaagttcttgaaaaagcaaggtttg
gacttcaaattaagcaccaaagttatttctgcaaagagaaacgacgacaagaacgtcgtc
gaaattgttgtagaagatactaaaacgaataagcaagaaaatttggaagctgaagttttg
ctggttgctgttggtagaagaccttacattgctggcttaggggctgaaaagattggatta
gaagtagacaaaaggggacgcctagtcattgatgaccaatttaattccaagttcccacac
attaaagtggtaggagatgttacatttggtccaatgctggctcacaaagccgaagaggaa
ggtattgcagctgtcgaaatgttgaaaactggtcacggtcatgtcaactataacaacatt
ccttcggtcatgtattctcacccagaagtagcatgggttggtaaaaccgaagagcaattg
aaagaagccggcattgactataaaattggtaagttcccctttgcggccaattcaagagcc
aagaccaaccaagacactgaaggtttcgtgaagattttgatcgattccaagaccgagcgt
attttgggggctcacattatcggtccaaatgccggtgaaatgattgctgaagctggctta
gccttagaatatggcgcttccgcagaagatgttgctagggtctgccatgctcatcctact
ttgtccgaagcatttaaggaagctaacatggctgcctatgataaagctattcattgttga

DBGET integrated database retrieval system