KEGG   Saccharomyces cerevisiae (budding yeast): YFL037WHelp
Entry
YFL037W           CDS       T00005                                 

Gene name
TUB2, ARM10, SHE8
Definition
(RefSeq) beta-tubulin
  KO
K07375  tubulin beta
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YFL037W (TUB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YFL037W (TUB2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YFL037W (TUB2)
   04147 Exosome [BR:sce04147]
    YFL037W (TUB2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     YFL037W (TUB2)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    YFL037W (TUB2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YFL037W (TUB2)
  Exosomal proteins of colorectal cancer cells
   YFL037W (TUB2)
  Exosomal proteins of bladder cancer cells
   YFL037W (TUB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2 Misat_Tub_SegII
Motif
Other DBs
NCBI-GeneID: 850506
NCBI-ProteinID: NP_116616
SGD: S000001857
UniProt: P02557
Structure
PDB: 

Position
VI:56336..57709
Genome map
AA seq 457 aa AA seqDB search
MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKERLNVYFNEASSGKWV
PRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVI
RREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVV
EPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSL
RYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMM
AAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQG
LDMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVS
EYQQYQEATVEDDEEVDENGDFGAPQNQDEPITENFE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatcattcatatctcgacaggtcagtgtggtaaccaaattggtgctgcattc
tgggaaactatctgtggtgagcacggtttggatttcaatgggacatatcacggccatgac
gatatccagaaggagagactgaacgtgtacttcaacgaggcatcttctgggaagtgggtt
ccaagatctattaacgtcgatctagaacctgggacgattgacgcagtacgcaattctgcc
atcgggaatttgtttagacctgacaattatatctttgggcaaagttctgcgggcaacgtg
tgggccaagggtcactacacagaaggtgctgagcttgtagacagcgtcatggatgttatt
agacgagaggccgaaggatgcgactcccttcaaggtttccagatcacacattctcttggt
ggtggtaccggttccggtatgggtacgcttttgatctcgaagattagggaagagtttcct
gatcgtatgatggccaccttctccgtcttgccctctccgaagacttctgacaccgttgtc
gaaccatacaatgccacgttgtctgtgcaccaattggtagaacactctgatgaaacattc
tgtatcgataacgaagcactttatgacatctgtcaaaggaccttaaagttgaatcaacct
tcttatggagatttgaacaacttggtctcgagcgtcatgtctggtgtgacaacttcattg
cgttatcccggccaattgaactctgatttgagaaagttggctgttaatcttgtcccattc
ccacgtttacatttcttcatggtcggctacgctccattgacggcaattggctctcaatca
tttagatctttgactgtccctgaattaacacagcaaatgtttgatgccaagaacatgatg
gctgctgccgatccaagaaacggtagataccttaccgttgcagccttctttagaggtaaa
gtttccgttaaggaggtggaagatgaaatgcataaagtgcaatctaaaaactcagactat
ttcgtggaatggatccccaacaatgtgcaaactgctgtgtgttctgtcgctcctcaaggt
ttggacatggctgctactttcattgctaactccacatctattcaagagctattcaagaga
gttggtgaccaattttccgctatgttcaaaagaaaagctttcttgcactggtatactagt
gaaggtatggacgaattggaattctctgaggctgaatctaatatgaatgatctggttagc
gaataccaacaataccaagaggctactgtagaagatgatgaagaagtcgacgaaaatggc
gattttggtgctccacaaaaccaagatgaaccaatcactgagaattttgaataa

DBGET integrated database retrieval system