KEGG   Saccharomyces cerevisiae (budding yeast): YFL046WHelp
Entry
YFL046W           CDS       T00005                                 

Gene name
FMP32
Definition
(RefSeq) Fmp32p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1640 DUF3584 FTA4 Lipid_bd ZnuA XhlA DUF4407 Uso1_p115_C Phage_lysis Fib_alpha
Motif
Other DBs
NCBI-GeneID: 850498
NCBI-ProteinID: NP_116608
SGD: S000001848
UniProt: P43557
Position
VI:42815..43438
Genome map
AA seq 207 aa AA seqDB search
MLKRIVGLPARRCFHRTSFLLGSDFETVHIPNTNHFKDLLIENGKFQEDQATTIVEIMTD
AIRGGVNHVSQDLAKREKLTQLSYQQRVDFAKLRDQLLSADRSEFHNIQNEYESVKNDLE
KLRNKLREEITKTNAGFKLDLSLEKGRIREESSHHDLQIKEIDTKIEQEVTNMKMQIDSV
KTQVMQWLIGVCTGTFALVLAYMRLLT
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgtattgttggattgcctgcaaggcgttgctttcatagaacgtcctttttg
ctgggcagtgactttgaaactgtgcatattcccaatacgaaccactttaaagatttactt
atagagaacggtaaatttcaagaggatcaagcaactacaatagtagagataatgacagat
gcaattaggggcggggttaatcatgtttcacaggatctggcaaagagagaaaaattgacc
caacttagctatcaacaacgtgttgattttgcaaagttaagagatcagctattgagtgct
gatagaagtgaatttcacaatattcaaaacgagtacgaaagtgtgaaaaacgatctggag
aaactaagaaacaaactaagggaagaaattaccaaaacaaacgccggtttcaaacttgat
ctgtccttagaaaaaggcagaattagggaagaaagtagtcatcacgatctgcaaataaaa
gaaatcgacaccaaaattgagcaagaagtgaccaatatgaagatgcagattgattctgtc
aagactcaagtcatgcaatggctgataggtgtctgtacaggtacatttgcacttgtatta
gcatatatgaggttattaacatag

DBGET integrated database retrieval system