KEGG   Saccharomyces cerevisiae (budding yeast): YFR010W
Entry
YFR010W           CDS       T00005                                 

Gene name
UBP6
Definition
(RefSeq) ubiquitin-specific protease UBP6
  KO
K11843  ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YFR010W (UBP6)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YFR010W (UBP6)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YFR010W (UBP6)
Peptidases and inhibitors [BR:sce01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   YFR010W (UBP6)
Ubiquitin system [BR:sce04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    YFR010W (UBP6)
SSDB
Motif
Pfam: UCH UCH_1 ubiquitin
Other DBs
NCBI-GeneID: 850562
NCBI-ProteinID: NP_116665
SGD: S000001906
UniProt: P43593
Structure
PDB: 
1VJV 5A5B

Position
VI:165067..166566
AA seq 499 aa
MSGETFEFNIRHSGKVYPITLSTDATSADLKSKAEELTQVPSARQKYMVKGGLSGEESIK
IYPLIKPGSTVMLLGTPDANLISKPAKKNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYL
NATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVIEMKRCFENLQNKSFKSVL
PIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFTQLFHSMSIVFGDKFSEDFRIQFKTT
IKDTANDNDITVKENESDSKLQCHISGTTNFMRNGLLEGLNEKIEKRSDLTGANSIYSVE
KKISRLPKFLTVQYVRFFWKRSTNKKSKILRKVVFPFQLDVADMLTPEYAAEKVKVRDEL
RKVEKEKNEKEREIKRRKFDPSSSENVMTPREQYETQVALNESEKDQWLEEYKKHFPPNL
EKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESL
AGGGESDSALILMYKGFGL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgagcggagaaacgtttgagttcaatattagacattctggtaaagtttacccaataaca
ctttccactgatgctacttcagcagatttgaaaagcaaagcagaggaattgacccaagtc
ccaagtgcccgccaaaaatacatggttaaaggtggcttgtctggcgaagagtccattaaa
atatatcccttaatcaagccaggatcgacagtaatgctattggggactccagatgctaac
ctgatttctaaaccagccaaaaagaataatttcattgaagaccttgcgcctgagcaacaa
gtccaacaatttgctcaattgcctgttggtttcaagaatatgggcaacacctgttatctg
aatgctaccctacaggctttatacagagtgaacgatttaagggatatgattcttaattat
aacccttctcaaggtgtgtctaacagtggtgcacaagatgaagagattcacaaacaaatc
gttattgaaatgaagcgttgttttgaaaatttacagaataaaagtttcaagagtgttttg
ccaattgtgttattaaacacgctaagaaagtgttatccacaatttgctgaacgtgattca
caaggtgggttctataaacagcaagacgctgaggagttgtttacacaactattccatagt
atgagtattgtttttggtgacaaattttccgaagatttcaggattcaatttaaaactacc
atcaaagacacagctaatgataacgatattactgttaaagaaaatgaaagcgattctaaa
ttacaatgtcatatttctggtactacaaatttcatgagaaatgggctcctggaaggtttg
aatgagaaaattgaaaaaagatcagacttgactggcgccaattccatctatagcgtcgaa
aagaaaatatcaagattaccaaagtttttaactgttcagtacgttagatttttctggaaa
aggtcaaccaacaaaaaatctaaaatattgcgtaaggtcgttttcccatttcaattagat
gttgcagacatgcttaccccagaatacgcagcagagaaggtaaaagttcgtgacgaactg
agaaaagttgaaaaggagaaaaatgaaaaggaaagagagatcaaaaggcgtaaatttgac
ccatcatccagtgaaaatgtcatgacaccaagagaacaatatgagacacaagtggctctt
aacgaaagtgaaaaagatcaatggctcgaagagtataagaaacattttcctccaaacttg
gaaaaaggtgaaaacccatcttgtgtttataacttgatcggtgtcattacacatcaaggt
gccaattctgagtctggacactatcaagctttcataagggacgaactggacgaaaataaa
tggtacaaatttaatgatgataaagttagcgttgttgaaaaggaaaaaattgaatcttta
gccggtgggggcgaaagtgatagtgcactgatcttaatgtataaaggatttggtctgtaa

DBGET integrated database retrieval system