KEGG   Saccharomyces cerevisiae (budding yeast): YFR024C-AHelp
Entry
YFR024C-A         CDS       T00005                                 

Gene name
LSB3, YFR024C
Definition
(RefSeq) Lsb3p
  KO
K20523  SH3 domain-containing YSC84-like protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YFR024C-A (LSB3)
Membrane trafficking [BR:sce04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    YFR024C-A (LSB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ysc84 SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 850580
NCBI-ProteinID: NP_219497
SGD: S000002968
UniProt: P43603
Structure
PDB: 

Position
VI:complement(join(201960..203292,203387..203433))
Genome map
AA seq 459 aa AA seqDB search
MGINNPIPRSLKSETKKAAKILASFVKPNQVFGADQVIPPDVLKRAKGLAIITILKAGFL
FSGRAGSGVIVARLKDGTWSAPSAIAMAGAGAGGMVGIELTDFVFILNTQDAVKSFSEFG
TITLGGNVSVSAGPLGRSAEAAASASAGGVAAVFAYSKSKGLFAGVSVEGSAIIERREAN
RKFYGDNCTAKMILSGRIRPPPAVDPLFRVLESRAFNYRPSNGGRGSFDDDEDDYYDDDD
YYNDIPSSFSSTDASSTRPNTRSTRRRAQSGSRYTFDDDDDDDDYGTGYSRNSRLAPTNS
GGSGGKLDDPSGASSYYASHRRSGTAQSRARSSRNRWADDEYDDYDDDYESGYRRGNGRD
RTKDREVDDLSNRFSKSRISSASTPQTSQGRFTAPTSPSTSSPKAVALYSFAGEESGDLP
FRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgggtattaacaatcctattccaaggagtttaaagagtgagacaaaaaaagcagcgaag
attttggctagttttgtcaaaccaaaccaagtttttggtgcggaccaagtcattcctcca
gacgttttgaaaagagctaaagggttggctatcataacgatcttaaaagcaggttttcta
ttttcaggtagagctggttctggtgtgattgtcgcaagattaaaggatggtacttggtca
gctccatctgccattgccatggcaggtgctggtgccggtgggatggttggtatagaattg
actgattttgttttcattttaaatactcaggatgctgttaagtcgttttctgaatttggg
accatcacgttgggtggtaacgtctccgtttctgctgggcctcttggtagaagtgcagaa
gcagctgcatcagcctccgccggtggtgtggctgcagtttttgcctattctaagagtaaa
ggtctatttgcaggggtttctgtggaaggttcggctattatagaaagaagagaggctaac
agaaaattttatggtgacaattgtaccgcgaaaatgattttgtctggtaggataagaccg
cctccagcagttgatccattgtttcgtgttttagagtccagggcgtttaattacagaccc
tccaacggtggtcgtggcagtttcgatgacgacgaagacgattactatgacgacgacgat
tactataatgacattcctagttcattcagttctacagatgcttcctccactagacctaac
acaagatccacaaggagaagagcccaaagcggttctcgttatacgttcgacgatgatgat
gacgatgatgattatggtactggctattcaaggaattcaagactggctcctaccaacagt
ggcggtagtggtggtaaattggatgacccatctggagcttcaagttattatgccagccac
agaagatcaggaactgctcagtcaagggctcgttcttcaagaaatcgttgggctgatgat
gaatacgatgattatgatgatgattatgaatccgggtatagacgcgggaatggaagagat
aggacaaaagaccgtgaagtcgatgacttgtcgaacagattttctaaatctagaatctcg
tccgcttcaacaccgcaaactagtcagggcagattcactgctccaacatccccatccacg
tcttctccaaaggccgtggcattatatagctttgcaggagaagagtccggagatttacca
ttcagaaagggtgacgtgatcacaattttgaaaaaatcagattctcaaaatgactggtgg
accggaagagtcaacggtagagaaggtatattcccagcaaattacgttgaactagtttaa

DBGET integrated database retrieval system