KEGG   Saccharomyces cerevisiae (budding yeast): YFR051CHelp
Entry
YFR051C           CDS       T00005                                 

Gene name
RET2
Definition
(RefSeq) coatomer subunit delta
  KO
K20471  coatomer subunit delta
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YFR051C (RET2)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    YFR051C (RET2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Clat_adaptor_s Adap_comp_sub DUF5559 CDC37_N AAA_assoc
Motif
Other DBs
NCBI-GeneID: 850612
NCBI-ProteinID: NP_116709
SGD: S000001947
UniProt: P43621
Structure
PDB: 

Position
VI:complement(250163..251803)
Genome map
AA seq 546 aa AA seqDB search
MVVLAASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVEDKHVRYVYR
PFDNYYIILITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSM
GGYKENLSFTQVQTYLSMESHEERIQEIIERNKEIEATEERKRRAKEIARKEHERKHGFM
SSNGDYDGANRFMGSKDPNVTNAINSYYSHASPAAQQSYLQSSHAAAAEVAPVASPMATS
QRAGHSATGGMKLGGGAGRRAGAAPRPSAISSASSGTPPPPEEDVPENNGILISIKEVIN
AEFSRDGTIHSSELKGVLELRINDHDLSHSNLKLADSIDVRDKSFQFKTHPNIDKQSFLS
TKLISLRDKSKAFPANDQSLGVLRWRKVAPAEDDSLIPLTLTTWVSPSESQQGFDVIIEY
ESVLETELADVIFTIPVFPQEPVDINTESSTCSDAEVVNMDQEMGTSIKISKIAANDAGA
LAFTIEAPYEDALYPMTVSFQESTRDKLAKSFTGMAIQSVVMANDHDQELPYDVITSLKS
DEYLVQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggtggttttggctgcttctatcactacgcgtcaggggaaacctctcttgtccaggcaa
ttcaaagatctgtccaaggatcgagtcctagagttgctgtccaatttccagaacctagtc
tccgagatctcgtcagaccacacatttgtcgaggacaagcacgtccgctacgtgtatagg
ccctttgataactactacattattcttatcacaaaccgccagtccaatattatcaaggat
ttggccacattaaatctgttttcacagacgatcaactcctacttgtctagtttccaagac
caagagatttttcacaatgcctttgagatcttgtcctcgttcgacgaaatcgtgtcaatg
ggcgggtacaaagagaacttgtcctttactcaagtgcaaacatacttgtctatggagtcg
cacgaagaaagaatccaggaaattattgagcgtaataaagagatcgaagctactgaggag
aggaagcgccgtgctaaggaaattgctagaaaagaacatgaaaggaaacacgggtttatg
tcttcaaatggcgattacgacggcgccaataggttcatgggaagtaaagatcctaacgtt
acaaacgccatcaacagttactactcccatgcttctcctgcagcacaacagtcttatcta
caaagttcccatgccgctgctgctgaggtggccccagtggcctccccaatggctacgtct
cagcgtgcgggacattctgctactggcggtatgaaattgggtggtggtgccggaagaaga
gcgggtgccgcaccacggccaagtgcaatttcttcagcctcttctggcactccacctcct
ccggaggaggatgtcccagagaacaatggtattttgatctctatcaaggaggtaatcaat
gcagaattctccagagatggtaccattcactcttctgaattgaaaggtgttttagaacta
agaattaatgaccatgacttatctcactcgaacctaaaactagctgattctattgacgtt
cgcgataaatccttccagtttaagacccatccaaacatagataaacaatcgttcctatcc
actaaacttatctccctgcgtgataaatctaaggctttcccagccaacgaccaaagcctg
ggtgttctaagatggcgtaaagtcgctcccgcagaagatgactcattaattccattaact
ctaactacatgggtttccccctccgaatcacaacagggctttgatgtcattattgagtat
gagagcgtcctggaaacagaactcgctgatgtgatcttcaccattccagttttccctcag
gagccagtagacataaatacagagtcttctacatgctctgacgctgaagttgtcaacatg
gaccaagaaatgggaacctccattaagattagcaaaattgctgccaacgatgcaggtgcg
ctagcattcactatcgaagctccatatgaagatgcattgtacccaatgaccgtttccttc
caagagtccacgagggataaattagctaagagtttcaccggtatggccatacaatctgtt
gtcatggccaatgaccacgatcaagagctcccttacgacgtcatcacctctttgaaatca
gatgaatatcttgtccaatag

DBGET integrated database retrieval system