KEGG   Saccharomyces cerevisiae (budding yeast): YFR053CHelp
Entry
YFR053C           CDS       T00005                                 

Gene name
HXK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00051  Fructose and mannose metabolism
sce00052  Galactose metabolism
sce00500  Starch and sucrose metabolism
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YFR053C (HXK1)
   00051 Fructose and mannose metabolism
    YFR053C (HXK1)
   00052 Galactose metabolism
    YFR053C (HXK1)
   00500 Starch and sucrose metabolism
    YFR053C (HXK1)
   00520 Amino sugar and nucleotide sugar metabolism
    YFR053C (HXK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YFR053C (HXK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YFR053C (HXK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     YFR053C (HXK1)
Membrane trafficking [BR:sce04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    YFR053C (HXK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 850614
NCBI-ProteinID: NP_116711
SGD: S000001949
UniProt: P04806
Structure
PDB: 

Position
VI:complement(253592..255049)
Genome map
AA seq 485 aa AA seqDB search
MVHLGPKKPQARKGSMADVPKELMDEIHQLEDMFTVDSETLRKVVKHFIDELNKGLTKKG
GNIPMIPGWVMEFPTGKESGNYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKLPHDMRT
TKHQEELWSFIADSLKDFMVEQELLNTKDTLPLGFTFSYPASQNKINEGILQRWTKGFDI
PNVEGHDVVPLLQNEISKRELPIEIVALINDTVGTLIASYYTDPETKMGVIFGTGVNGAF
YDVVSDIEKLEGKLADDIPSNSPMAINCEYGSFDNEHLVLPRTKYDVAVDEQSPRPGQQA
FEKMTSGYYLGELLRLVLLELNEKGLMLKDQDLSKLKQPYIMDTSYPARIEDDPFENLED
TDDIFQKDFGVKTTLPERKLIRRLCELIGTRAARLAVCGIAAICQKRGYKTGHIAADGSV
YNKYPGFKEAAAKGLRDIYGWTGDASKDPITIVPAEDGSGAGAAVIAALSEKRIAEGKSL
GIIGA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaagaaaccacaggctagaaagggttccatggctgatgtgccc
aaggaattgatggatgaaattcatcagttggaagatatgtttacagttgacagcgagacc
ttgagaaaggttgttaagcactttatcgacgaattgaataaaggtttgacaaagaaggga
ggtaacattccaatgattcccggttgggtcatggaattcccaacaggtaaagaatctggt
aactatttggccattgatttgggtggtactaacttaagagtcgtgttggtcaagttgagc
ggtaaccatacctttgacaccactcaatccaagtataaactaccacatgacatgagaacc
actaagcaccaagaggagttatggtcctttattgccgactctttgaaggactttatggtc
gagcaagaattgctaaacaccaaggacaccttaccattaggtttcaccttctcgtaccca
gcttcccaaaacaagattaacgaaggtattttgcaaagatggaccaagggtttcgatatt
ccaaatgtcgaaggccacgatgtcgtcccattgctacaaaacgaaatttccaagagagag
ttgcctattgaaattgtagcattgattaatgatactgttggtactttaattgcctcatac
tacactgacccagagactaagatgggtgtgattttcggtactggtgtcaacggtgctttc
tatgatgttgtttccgatatcgaaaagttggagggcaaattagcagacgatattccaagt
aactctccaatggctatcaattgtgaatatggttccttcgataatgaacatttggtcttg
ccaagaaccaagtacgatgttgctgtcgacgaacaatctccaagacctggtcaacaagct
tttgaaaagatgacctccggttactacttgggtgaattgttgcgtctagtgttacttgaa
ttaaacgagaagggcttgatgttgaaggatcaagatctaagcaagttgaaacaaccatac
atcatggatacctcctacccagcaagaatcgaggatgatccatttgaaaacttggaagat
actgatgacatcttccaaaaggactttggtgtcaagaccactctgccagaacgtaagttg
attagaagactttgtgaattgatcggtaccagagctgctagattagctgtttgtggtatt
gccgctatttgccaaaagagaggttacaagactggtcacattgccgctgacggttctgtc
tataacaaatacccaggtttcaaggaagccgccgctaagggtttgagagatatctatgga
tggactggtgacgcaagcaaagatccaattacgattgttccagctgaggatggttcaggt
gcaggtgctgctgttattgctgcattgtccgaaaaaagaattgccgaaggtaagtctctt
ggtatcattggcgcttaa

DBGET integrated database retrieval system