KEGG   Saccharomyces cerevisiae (budding yeast): YGL001C
Entry
YGL001C           CDS       T00005                                 

Gene name
ERG26
Definition
(RefSeq) sterol-4-alpha-carboxylate 3-dehydrogenase (decarboxylating)
  KO
K07748  sterol-4alpha-carboxylate 3-dehydrogenase (decarboxylating) [EC:1.1.1.170]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00100  Steroid biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Module
sce_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    YGL001C (ERG26)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.170  3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase (decarboxylating)
     YGL001C (ERG26)
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 NAD_binding_10 Polysacc_synt_2 KR NmrA
Other DBs
NCBI-GeneID: 852883
NCBI-ProteinID: NP_011514
SGD: S000002969
UniProt: P53199
Position
VII:complement(495453..496502)
AA seq 349 aa
MSKIDSVLIIGGSGFLGLHLIQQFFDINPKPDIHIFDVRDLPEKLSKQFTFNVDDIKFHK
GDLTSPDDMENAINESKANVVVHCASPMHGQNPDIYDIVNVKGTRNVIDMCKKCGVNILV
YTSSAGVIFNGQDVHNADETWPIPEVPMDAYNETKAIAEDMVLKANDPSSDFYTVALRPA
GIFGPGDRQLVPGLRQVAKLGQSKFQIGDNNNLFDWTYAGNVADAHVLAAQKLLDPKTRT
AVSGETFFITNDTPTYFWALARTVWKADGHIDKHVIVLKRPVAICAGYLSEWVSKMLGKE
PGLTPFRVKIVCAYRYHNIAKAKKLLGYTPRVGIEEGINKTLAWMDEGL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtcaaagatagattcagttttaattatcggtggttctggttttcttggattgcactta
attcagcaattttttgatattaatcctaagccagacatccacatttttgatgttagagat
ctccctgaaaaactttcaaaacagtttacttttaatgtagacgacataaaatttcataag
ggtgatttaacatcacctgatgatatggaaaacgcaattaacgaaagtaaagcaaatgtt
gttgttcattgtgcttctccaatgcatggtcaaaatccagatatttatgacatagtgaat
gttaagggaacccgtaacgtgatagatatgtgcaagaaatgtggcgttaatatacttgta
tatacttcctctgctggtgttatttttaatgggcaagatgtgcacaatgcagacgaaacc
tggccaatcccagaagttcctatggatgcgtacaatgagactaaagctatcgccgaagat
atggtcttgaaggcgaatgatccaagcagtgatttctatactgttgctcttcgtccagct
ggtatttttggcccaggtgataggcaattagtacctggtctaagacaggttgcgaaattg
gggcagtcgaagttccaaattggtgataataacaatctatttgattggacttatgctgga
aatgttgctgacgcgcatgtgttagctgcacagaaacttctcgatccaaaaacaagaact
gctgtctcgggtgaaacttttttcattaccaatgatacccccacctatttttgggccttg
gcccgtactgtgtggaaggcagatggtcatattgataaacatgttattgttttgaaaagg
ccagttgcaatttgtgcaggttatctttcagaatgggtatccaagatgctgggtaaagag
ccaggtttgactccattcagagtcaagattgtgtgtgcataccgttatcacaacattgct
aaggccaaaaagttgctaggctacacaccaagagttggtattgaagaaggaattaacaaa
acgttggcctggatggacgaaggtttgtaa

DBGET integrated database retrieval system