KEGG   Saccharomyces cerevisiae (budding yeast): YGL003CHelp
Entry
YGL003C           CDS       T00005                                 

Gene name
CDH1, HCT1
Definition
(RefSeq) Cdh1p
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
Module
sce_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YGL003C (CDH1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGL003C (CDH1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     YGL003C (CDH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Motif
Other DBs
NCBI-GeneID: 852881
NCBI-ProteinID: NP_011512
SGD: S000002971
UniProt: P53197
Structure
PDB: 

Position
VII:complement(492474..494174)
Genome map
AA seq 566 aa AA seqDB search
MSTNLNPFMNNTPSSSPLKGSESKRVSKRPISSSSSASLLSSPSRRSRPSTVYGDRYIPS
RTDIDFNSIVSISSMASVPALNPSSTEDQVEYQKERQAHETYNTLLKNELFGEMLSKDTV
GSESSIDRIKNTRPSTRGNVHAENTTRHGYELERVSTPPPEAAGLEEFSPHSTPVTPRRL
FTSQQDEITRPSSNSVRGASLLTYQQRKGRRLSAASLLQSQFFDSMSPVRPDSKQLLLSP
GKQFRQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCD
TENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSG
SRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPI
LTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWS
KNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLR
YWKLFDKPKAKVQPNSLIFDAFNQIR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaaacctgaacccattcatgaataatacgccttcctcctccccactcaagggt
tctgaaagtaagagggtatcgaaaaggccaatatctagttcttcgtccgcctcactatta
tcatctccctccaggcgatcgaggccgtctacagtatatggtgataggtatattccttcc
cgaacagatatagatttcaattccatcgtttccatcagtagtatggcaagcgttccagcc
cttaatccatcgagtacggaagatcaagtagaataccaaaaggaaagacaggcacatgaa
acttataatactttgctgaagaatgagctttttggcgagatgctaagcaaggatacggta
ggctcagagagcagtatagatcgcattaagaatacgagaccatctactagaggcaatgtg
cacgcagaaaatacaactagacatggttatgaactggaacgagtatcaactccacctcct
gaagctgctggtttagaggaattttcgccacattccacgccagtcactcctcgacgtctt
tttacatcacagcaagatgaaatcacgagaccctcaagcaactcagttaggggcgccagc
ctgttgacttatcaacaacgtaaaggtagaagactatctgcggcctctttgttacaatct
caattttttgattccatgtcgccagttaggccggattccaaacagctcctattatcaccg
gggaagcaatttagacaaatagctaaagttccctatagagttttagatgccccatcatta
gcagacgatttttactacagcttgatagattggtcaagtactgatgttttggcagttgct
cttggaaaatcgatttttttaaccgataataacactggcgacgttgttcacttatgcgac
acggaaaacgaatacacaagcttaagctggattggagcaggctctcatctggcagtaggt
caagcaaatggacttgtagaaatttatgacgtaatgaaaagaaaatgtattaggacgttg
tcgggacatattgacagagtagcgtgtttatcttggaataatcatgttttgacgtctggg
agtagagatcatcgaatactgcatagggatgttaggatgccagatcccttttttgaaact
atagaatcgcacactcaggaagtctgtggcctaaagtggaatgtagcggacaacaaactt
gcctcaggtggtaacgataacgtcgtccatgtttacgaaggaacgtcgaaatctccaatc
ttgacgtttgacgaacataaggctgctgttaaggcaatggcctggtctcctcataaacga
ggtgtgctagctaccggtggtggtacagcagatagaagactaaaaatctggaacgttaat
acgtcaataaagatgagtgatatagatagcggctctcaaatatgtaatatggtatggtca
aagaatactaacgagcttgtgacatcacatggttactcaaaatataacttaaccttgtgg
gactgtaactctatggatccaattgcaattctgaaaggtcatagtttcagggttctgcat
ttaacgttatccaatgatggaaccacggtggtttctggggctggagatgaaacattgcga
tattggaaactttttgataaaccaaaagcgaaggtacagccaaattcgttaatatttgac
gcatttaatcaaatacgttag

DBGET integrated database retrieval system