KEGG   Saccharomyces cerevisiae (budding yeast): YGL006W
Entry
YGL006W           CDS       T00005                                 

Gene name
PMC1
Definition
(RefSeq) calcium-transporting ATPase PMC1
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YGL006W (PMC1)
Enzymes [BR:sce01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     YGL006W (PMC1)
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 852878
NCBI-ProteinID: NP_011509
SGD: S000002974
UniProt: P38929
Position
VII:485921..489442
AA seq 1173 aa
MSRQDENSALLANNENNKPSYTGNENGVYDNFKLSKSQLSDLHNPKSIRSFVRLFGYESN
SLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLL
TVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKEL
QFAKLNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADES
SITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRIL
SGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLF
TRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRM
TKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRK
LNSKKVFEENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKS
RLSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQP
MEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSD
DTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDL
LFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILS
TDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTG
DGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFI
QFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDR
KPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSHQQQQLNAMT
FNTFVWLQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIGSCQV
LIMFFGGAPFSIARQTKSMWITAVLCGMLSLIMGVLVRICPDEVAVKVFPAAFVQRFKYV
FGLEFLRKNHTGKHDDEEALLEESDSPESTAFY
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgtctagacaagacgaaaattctgctttactagcgaataatgaaaataacaaaccatcg
tatacgggaaatgagaacggagtctacgataatttcaaattatcaaaaagtcaactttcg
gatcttcataaccctaaatcaataagatcatttgtcagattatttggatatgagtctaac
agcctcttcaaatacttgaaaacagataaaaatgcaggcatttctcttccagaaatatca
aattatcgaaagacaaaccggtataaaaattatggcgataattcacttcctgaaagaata
ccaaagtcttttttacaattagtatgggctgcttttaatgacaaaacaatgcaattactg
acagtcgccgctgttgtttcctttgttttaggtctatacgaactatggatgcaacctcca
cagtatgatcctgaaggaaataaaattaagcaagttgactggattgaaggggttgctatc
atgattgcggtctttgtggtagttctagtgagtgccgctaacgattaccagaaggagttg
caatttgcaaagctaaataaaaagaaggaaaaccgtaaaattatagtcataagaaatgat
caggaaatattaatttccattcaccacgttttagtcggtgatgtcatttcattacaaacc
ggtgatgttgtccccgctgattgtgttatgatatcagggaagtgtgaggcagatgaatca
tccatcactggtgaatctaacacaatacagaaatttccggtggataactcattaagagat
ttcaaaaaatttaattctatcgatagtcataaccatagcaaaccattagatataggtgac
gttaacgaagacggtaacaagattgctgattgtatgttgatttcaggttccagaattctc
tctggcttgggcaggggtgtcatcacgtccgtgggtataaactcagtttacggtcaaacc
atgacttcattaaatgccgaacctgaaagtactccattacagttacatttgagccaattg
gctgataatatatccgtttacggttgcgtgtctgctataattcttttcttggtccttttc
actaggtacttattttacataatacctgaggatggcaggttccatgatctagatcccgct
caaaagggttctaaatttatgaacatttttatcacatctatcacggttattgtggtggct
gttccggaaggtttaccattagctgtaactttggccttagcgtttgcaacaacaagaatg
acaaaagacggtaatttagtacgggttttaagaagctgtgaaacgatgggatctgctact
gcagtgtgctctgataagactggcactttgacagaaaatgtcatgactgtcgttcgtggc
ttcccgggcaattctaaatttgatgatagtaaatcgttgcccgttagcgaacaaaggaag
ctgaattctaagaaagtttttgaagaaaattgttcgtcatccttgagaaatgatttatta
gccaatattgtcctgaattctaccgccttcgaaaacagagattataagaaaaacgataaa
aatacaaatggtagtaaaaatatgtcaaaaaatttgagttttttagataagtgtaaatct
agattatcgttttttaaaaaaggcaacagggaagatgacgaggatcaattattcaaaaat
gtcaacaagggtaggcaagaaccctttattggctctaaaacggaaacagccttactcagt
ttggcaagattatcattaggattacaaccgggagaattgcaatatttgagagatcaaccg
atggaaaagtttaatatcgaaaaagttgttcaaacaattccgtttgaaagttctcgtaaa
tgggccggcttagtggtaaagtacaaagaaggcaaaaataaaaaaccattttacaggttt
ttcattaaaggtgcagcagaaattgtttccaagaattgttcgtacaagaggaattcagat
gatactttggaagaaatcaatgaggacaataaaaaagaaactgatgatgaaatcaaaaat
cttgcgtccgatgctctcagagccataagtgttgcccacaaagatttctgcgaatgtgat
agctggccccctgaacagctgcgtgataaagactcaccaaatatagctgctcttgacttg
ctatttaacagtcaaaagggcttaattctagatggtttacttgggattcaagacccttta
cgtgcaggcgttagggagtcagtacaacagtgccaacgtgctggtgtaactgtgcgtatg
gttactggtgacaatatattaacagcaaaagcaatcgcgaggaattgtgcgattctttct
actgatattagttcagaggcttattctgcaatggaaggcactgaattcagaaagttaacg
aaaaacgaacgtataagaatcctgccaaatttaagggtcttagcaaggtcttcgcctgag
gataaaaggttattagtagaaacattgaaggggatgggagatgttgttgcggtcactggc
gatggtacgaacgatgctccagctttaaagctagctgatgttggtttctcaatgggtatt
tccggtacggaggttgccagagaggcttctgacattattttgatgactgatgatttctca
gctattgtcaacgctattaagtggggaagatgtgtttcagtctccataaaaaagttcata
cagtttcaattaattgttaatatcaccgcagtgattttaacgttcgtttcatccgttgca
tctagtgatgaaacatcagtactgacggcggtccaactgttatggatcaatctaatcatg
gatactctagcagctttagctttagccactgataaacccgatccaaatatcatggacaga
aaacctaggggccgctcaacttctttgatttctgtgtcaacttggaaaatgattctatca
caagctacattgcagttgatagttactttcattttgcatttttacgggccagagttattc
ttcaagaaacatgaagatgaaataacaagtcaccaacagcagcaactgaatgccatgaca
ttcaacacttttgtttggttgcaattttttaccatgttagtatcgagaaaattagatgaa
ggtgatggtatatcaaactggagaggcaggatttctgccgccaatttgaatttcttccaa
gacttgggtagaaactattattttctcacgatcatggcgatcattggcagctgtcaagtt
ttaatcatgttttttggtggcgcaccattttctattgccagacaaaccaaatcaatgtgg
ataaccgcggtactgtgtggtatgttgtctctaatcatgggggtgctagtgagaatctgc
cccgatgaagtagcagtgaaggtatttccggctgctttcgttcaaagattcaagtacgta
tttggactcgagttcctcagaaaaaaccatactggaaaacacgacgatgaagaagcgctg
ttggaggaatctgatagtccagagtccaccgccttttattaa

DBGET integrated database retrieval system