KEGG   Saccharomyces cerevisiae (budding yeast): YGL021W
Entry
YGL021W           CDS       T00005                                 

Gene name
ALK1
Definition
(RefSeq) protein kinase ALK1
  KO
K16315  serine/threonine-protein kinase haspin [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YGL021W (ALK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YGL021W (ALK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YGL021W (ALK1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  Haspin family
   YGL021W (ALK1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    YGL021W (ALK1)
SSDB
Motif
Pfam: Haspin_kinase APH Pkinase Choline_kinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 852863
NCBI-ProteinID: NP_011494
SGD: S000002989
UniProt: P43633
Position
VII:454785..457067
AA seq 760 aa
MLLHFDIVIQLLSSHTLKSHQVEPPMDFETSFEEFVEDKRFIALEVSDNDDDCDTDLTAD
TADELESSAILKMRESDASLNVTTGNNTSRKTTSNSKKRWSLLSNHSAVSSSKSKKRWSV
LSSSFTSESHKDRESRNVLQQKRKSLQSYSSLDTVASNSSISASSSLKRSSTGLSLRQLF
TKIGINDDISQPGIGIPQGKENLPPTMGKKNSSIASTSSENRLRTPLKPLVNHSKRPTSQ
PQQQQPLYNASLSSRRSSISSTVSSSSSSKWRFWKRNKNQTPALLQPDHHSLKTFPAVNR
RDSMTPVEPRNMVKHKTSFSDFHKTIFSSNTYSESSDTISSMEITLKNKASSSSLSLNVL
KKRNSQSSLKHKSSHASLQKFKRNKGKSSMIAPSTATNSSNDDSCSYSSKNSTLSHRISL
PVPDQVSRDKIQNKLRYSTSLLSLNSKSSLPMNKNDHDETLLRQILLNCDIKRILNPAKG
DVLPLINDVNHLSSIQLTSNVWQIGEVICKKVSLGTIDDITWDRKFLSLQELEKLKIMQQ
KFDGIPQLLKSFVVKEANGGLYLYLLFKDHGTPISLISLKNWKQILKIFWSCAGIIHGLE
KNLKFEHRNLTLDNILIDGNGNITIIDFKCSRLQTPQDDVLYLRLDHPLFFLNGKDKSKI
NEYQYQFEFEIYQSMRILLNMDASAFEPMTNLYWLYYLSRVLLKFGDRKLGKNDANRDKM
ARVINHLEMNLAVHKRGGQLFKRLETEDIKNTGDLLKLYK
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgctacttcattttgacattgtaattcaattactatcaagtcatacccttaaatcgcac
caagtagagccccccatggattttgaaacgtcgttcgaagaatttgtcgaagataaacga
ttcattgctctagaggtatctgataatgatgacgattgtgacactgatttgactgctgac
acagctgacgagctggaaagctctgctatcttaaagatgagggagtctgatgcatcttta
aatgttaccaccggcaataatacatcaaggaaaacgacttccaattccaaaaaacgatgg
tctctattatccaatcattctgctgtttcatcatctaaatctaagaaaagatggtctgta
ctttcttcaagctttaccagtgaatctcataaggacagggaatcgaggaacgttttgcaa
caaaaaagaaaatccttgcagagttattcaagcttagatacggtagcatctaatagctct
atctctgcttcttcttctttgaaaagatcgtccactggtctttccctcagacaattgttt
accaagataggcataaacgatgatatatcacaacctgggatcgggattccgcaaggtaag
gaaaatctgcctccaactatgggcaaaaaaaattcatcaattgcttccactagttcggaa
aacagacttaggacaccattgaagccgcttgttaatcattctaaaaggcccacttcacaa
ccacaacagcaacaaccactatataatgcatcattgtcctcgagaagatcgtcgatttct
tccactgtctcttcttccagctcgtctaaatggagattctggaagagaaataagaaccag
acacctgcattgttgcaaccagaccaccattctttaaaaacctttcctgcagtaaaccgt
cgtgattccatgacgcccgttgaaccaagaaatatggtaaaacataagacatccttttca
gatttccataagactatcttcagttcaaatacgtattctgaaagcagcgatacaatatct
tccatggaaattactttgaaaaacaaagcttcttcctcaagtctatctttgaacgtgttg
aagaaaaggaattcgcaatcaagtttgaagcacaaaagttcacatgcatccttacaaaaa
ttcaaaagaaacaaaggaaagtcctccatgatagcaccatcgacagcaactaatagcagc
aatgatgactcttgtagctacagttccaaaaattctacgttgagtcaccgaatatcgtta
cctgtaccggaccaagtttcccgtgataaaattcagaacaaattaagatattcgacctca
ttactctcattaaattctaaatcatctttaccgatgaacaaaaatgatcatgatgagaca
cttctaagacagattttactaaattgtgatataaagagaattttaaaccccgcaaaagga
gatgtattgcctttaatcaacgatgtaaaccatttgtcatcaatacaattaacatcaaat
gtttggcaaattggtgaagtaatctgtaaaaaagtttctctcggtactattgatgacatt
acatgggatagaaagttcttatctttgcaggaactggaaaaactcaaaatcatgcaacaa
aaatttgatggcataccgcaactattgaaaagttttgttgttaaagaggcaaatgggggg
ttgtatttgtacttactattcaaagatcacggtaccccaatttcgttaatctcactgaaa
aactggaagcagattctaaagattttttggtcttgtgctggtataattcatgggttggaa
aaaaatttgaaatttgaacatcgtaatcttactttggataatattttgatagatggtaat
gggaatataacaattattgattttaaatgcagtagattgcaaactcctcaagatgatgtt
ttatatctacggctagatcatccactcttttttctaaatgggaaagacaagagtaaaata
aacgaataccagtatcaatttgagtttgaaatctatcaaagtatgcggatcttgttgaac
atggacgcgtcagcttttgagcccatgacaaatttgtattggttatattacctgtcacgc
gttttactaaagtttggtgacaggaagcttggtaagaatgatgcaaacagggataaaatg
gcaagggtgataaaccatttggaaatgaacttggcagttcataaaagaggggggcagtta
ttcaaaagattggagacggaggacattaagaatactggagatttactaaaactttataaa
taa

DBGET integrated database retrieval system