KEGG   Saccharomyces cerevisiae (budding yeast): YGL022WHelp
Entry
YGL022W           CDS       T00005                                 

Gene name
STT3
Definition
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00510  N-Glycan biosynthesis
sce00513  Various types of N-glycan biosynthesis
sce01100  Metabolic pathways
sce04141  Protein processing in endoplasmic reticulum
Module
sce_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YGL022W (STT3)
   00513 Various types of N-glycan biosynthesis
    YGL022W (STT3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YGL022W (STT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YGL022W (STT3)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     YGL022W (STT3)
Glycosyltransferases [BR:sce01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   YGL022W (STT3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STT3 PMT_2
Motif
Other DBs
NCBI-GeneID: 852862
NCBI-ProteinID: NP_011493
SGD: S000002990
UniProt: P39007
Structure
PDB: 

Position
VII:452404..454560
Genome map
AA seq 718 aa AA seqDB search
MGSDRSCVLSVFQTILKLVIFVAIFGAAISSRLFAVIKFESIIHEFDPWFNYRATKYLVN
NSFYKFLNWFDDRTWYPLGRVTGGTLYPGLMTTSAFIWHALRNWLGLPIDIRNVCVLFAP
LFSGVTAWATYEFTKEIKDASAGLLAAGFIAIVPGYISRSVAGSYDNEAIAITLLMVTFM
FWIKAQKTGSIMHATCAALFYFYMVSAWGGYVFITNLIPLHVFLLILMGRYSSKLYSAYT
TWYAIGTVASMQIPFVGFLPIRSNDHMAALGVFGLIQIVAFGDFVKGQISTAKFKVIMMV
SLFLILVLGVVGLSALTYMGLIAPWTGRFYSLWDTNYAKIHIPIIASVSEHQPVSWPAFF
FDTHFLIWLFPAGVFLLFLDLKDEHVFVIAYSVLCSYFAGVMVRLMLTLTPVICVSAAVA
LSKIFDIYLDFKTSDRKYAIKPAALLAKLIVSGSFIFYLYLFVFHSTWVTRTAYSSPSVV
LPSQTPDGKLALIDDFREAYYWLRMNSDEDSKVAAWWDYGYQIGGMADRTTLVDNNTWNN
THIAIVGKAMASPEEKSYEILKEHDVDYVLVIFGGLIGFGGDDINKFLWMIRISEGIWPE
EIKERDFYTAEGEYRVDARASETMRNSLLYKMSYKDFPQLFNGGQATDRVRQQMITPLDV
PPLDYFDEVFTSENWMVRIYQLKKDDAQGRTLRDVGELTRSSTKTRRSIKRPELGLRV
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgggatccgaccggtcgtgtgttttgtctgtgtttcagaccatcctcaagctcgtcatc
ttcgtggcgatttttggggctgccatatcatcacgtttgtttgcagtcatcaaatttgag
tctattatccatgaattcgacccctggttcaattatagggctaccaaatatctcgtcaac
aattcgttttacaagtttttgaactggtttgacgaccgtacctggtaccccctcggaagg
gttactggagggactttatatcctggtttgatgacgactagtgcgttcatctggcacgcc
ctgcgcaactggttgggcttgcccattgacatcagaaacgtttgtgtgctatttgcgcca
ctattttctggggtcaccgcctgggcgacttacgaatttacgaaagagattaaagatgcc
agcgctgggcttttggctgctggttttatagccattgtccccggttatatatctagatca
gtggcggggtcctacgataatgaggccattgccattacactattaatggtcactttcatg
ttttggattaaggcccaaaagactggctctatcatgcacgcaacgtgtgcagctttattc
tacttctacatggtgtcggcttggggtggatacgtgttcatcaccaacttgatcccactc
catgtctttttgctgattttgatgggcagatattcgtccaaactgtattctgcctacacc
acttggtacgctattggaactgttgcatccatgcagatcccatttgtcggtttcctacct
atcaggtctaacgaccacatggccgcattgggtgttttcggtttgattcagattgtcgcc
ttcggtgacttcgtgaagggccaaatcagcacagctaagtttaaagtcatcatgatggtt
tctctgtttttgatcttggtccttggtgtggtcggactttctgccttgacctatatgggg
ttgattgccccttggactggtagattttattcgttatgggataccaactacgcaaagatc
cacattcctatcattgcctccgtttccgaacatcaacccgtttcgtggcccgctttcttc
tttgatacccactttttgatctggctattccccgccggtgtattcctactattcctcgac
ttgaaagacgagcacgtttttgtcatcgcttactccgttctgtgttcgtactttgccggt
gttatggttagattgatgttgactttgacaccagtcatctgtgtgtccgccgccgtcgca
ttgtccaagatatttgacatctacctggatttcaagacaagtgaccgcaaatacgccatc
aaacctgcggcactactggccaaattgattgtttccggatcattcatcttttatttgtat
cttttcgtcttccattctacttgggtaacaagaactgcatactcttctccttctgttgtt
ttgccatcacaaaccccagatggtaaattggcgttgatcgacgacttcagggaagcgtac
tattggttaagaatgaactctgatgaggacagtaaggttgcagcgtggtgggattacggt
taccaaattggtggcatggcagacagaaccactttagtcgataacaacacgtggaacaat
actcacatcgccatcgttggtaaagccatggcttcccctgaagagaaatcttacgaaatt
ctaaaagagcatgatgtcgattatgtcttggtcatctttggtggtctaattgggtttggt
ggtgatgacatcaacaaattcttgtggatgatcagaattagcgagggaatctggccagaa
gagataaaagagcgtgatttctataccgcagagggagaatacagagtagatgcaagggct
tctgagaccatgaggaactcgctactttacaagatgtcctacaaagatttcccacaatta
ttcaatggtggccaagccactgacagagtgcgtcaacaaatgatcacaccattagacgtc
ccaccattagactacttcgacgaagtttttacttccgaaaactggatggttagaatatat
caattgaagaaggatgatgcccaaggtagaactttgagggacgttggtgagttaaccagg
tcttctacgaaaaccagaaggtccataaagagacctgaattaggcttgagagtctaa

DBGET integrated database retrieval system