KEGG   Saccharomyces cerevisiae (budding yeast): YGL023CHelp
Entry
YGL023C           CDS       T00005                                 

Gene name
PIB2
Definition
(RefSeq) Pib2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FYVE
Motif
Other DBs
NCBI-GeneID: 852861
NCBI-ProteinID: NP_011492
SGD: S000002991
UniProt: P53191
Position
VII:complement(450197..452104)
Genome map
AA seq 635 aa AA seqDB search
MTALHSVSKTPAIKEEEEDGDERDGRGVPLGPRNHDYRGRKGDEESGADTVTSPITFEKK
KIAPRASTHSEQSILSSISLKSMVNQHRQQQLQQESSTGAGTGFVDRKQQIQSPAMVSIL
RKNSAEENVRSSHSSKLGEGQIDGRKASASKEIGKTLPFTDDQRSNPELDPTNSVVDVSR
GKNTKSKTVFNELEDDADDDDEVRQKNLTTQALRKLSSFKMNASSNLRLSKENKAKESSS
SSTSSVSSSSTSKVENIVDKLTTTNSSSMSQLRFGNTNVIIDSVNHAAKPPHQQMLRKPS
LEFLPQPASSTNLNFNSNKHKSNVRQISNPKKPLYIPAVLRKVSETNITNDDLLNATLSS
YYKKASNLEHGFNPSKSQSASVQNANNLRIISSQSSVQSNTSSILESYKNKISSYLFPNS
IPNSDRINLIPTISNRNSARVNPPTKDHWIPDSKRNSCRYCHKPFTLWERKHHCRHCGDI
FCQDHLRHWLYLDSQANFIMINELNNGGINGGGTLCKICDDCLVEYENLSTTNHNANTNE
DNINVEEGEDDDNDNRKKLRNYYKNRQMNALFRPKKGGSSQEHATVDRDTTTPIQVKSND
EEADNENTGGEQEEGNDVLGSVIGSVPANWNWSSF
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgttgcatagtgtgtccaaaacgcccgcgatcaaggaagaggaggaggacggt
gatgagcgagacggcagaggagttcccctgggaccaaggaaccatgactaccgtggcagg
aaaggtgatgaggaaagcggtgctgacaccgtgacatctcccatcacgtttgaaaagaag
aagatagcgcccagggcgtcaacgcattccgaacagagtattttgagcagcatctcattg
aaatcgatggtaaatcaacatcgtcagcagcagttgcagcaagagagctcaacaggggca
ggcactgggtttgttgacagaaagcagcagatccaatctccggcgatggtgtccatattg
aggaagaactctgctgaggagaatgttcgcagcagccacagtagcaagctcggtgaaggg
cagatagatggtaggaaggcttctgctagtaaggagatcggcaagacgttgccattcacg
gatgaccaaagatcgaaccctgaactagatcccaccaatagcgtggtggatgttagcagg
ggcaagaatacaaagagcaaaactgtgttcaatgagttagaagatgatgccgatgacgat
gacgaggttcgacaaaagaatctaaccacgcaggcgttacgcaagttgtcgtcgttcaaa
atgaatgctagttctaatttgaggttgagtaaagaaaacaaggcgaaagagtcttcatct
tcgtccacgtcttcagtgtcgtcatcgtcgacgtcgaaggtggaaaatattgtcgacaag
ctgactacaacgaattctagctcgatgtcccaactgcggtttggcaacacgaacgtcatt
attgattcggtgaatcatgcggcgaaaccgccgcatcagcagatgctaaggaaaccctcg
ctggaatttttaccgcagcctgcttcgagcactaatctgaattttaattccaataaacat
aaatcaaatgtaagacagatcagtaaccctaaaaaaccgctatacatccccgccgtgctg
aggaaagtttcagagacaaacataactaatgacgatctgttgaatgcaacattgtcgtct
tactacaagaaggcatctaacctggaacatggctttaatccaagcaagtcgcaatccgct
agcgttcagaatgcgaacaacctacggatcatatcttctcaatccagcgtacaatccaac
acatcgtcaatcttggaaagctacaaaaacaaaatatcctcgtacttgttcccgaattct
attccgaacagcgacagaatcaacttaataccaactatttcaaacagaaactctgccaga
gtaaacccgcccactaaggaccactggattccggacagtaagaggaattcttgtcgttac
tgccataagccttttaccctgtgggaaaggaaacatcattgcaggcattgcggggacatc
ttttgtcaagaccatttgcgccattggctgtacctggactcgcaggcaaattttataatg
atcaacgaactaaacaacggtggcataaatggcggtggcactctctgtaaaatatgcgat
gactgtctggtcgagtacgagaacctttcaaccacgaaccataacgcaaacacgaacgag
gataacataaacgttgaggagggcgaagatgacgataatgacaataggaagaaattacgc
aattactacaagaataggcagatgaacgctcttttcagaccaaagaagggcggttcgtcc
caagagcatgccacggttgatcgagacacaacaacgcccatccaggtgaagtcgaacgac
gaagaagcagataatgagaatacggggggagaacaagaagaaggtaatgatgttttgggc
agtgttatcggctctgtgcctgcaaactggaattggagtagtttctga

DBGET integrated database retrieval system