KEGG   Saccharomyces cerevisiae (budding yeast): YGL025CHelp
Entry
YGL025C           CDS       T00005                                 

Gene name
PGD1, HRS1, MED3
Definition
(RefSeq) Pgd1p
  KO
K15155  mediator of RNA polymerase II transcription subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YGL025C (PGD1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Tail
     YGL025C (PGD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Med3 DUF1664 DUF1139
Motif
Other DBs
NCBI-GeneID: 852860
NCBI-ProteinID: NP_011490
SGD: S000002993
UniProt: P40356
Position
VII:complement(448764..449957)
Genome map
AA seq 397 aa AA seqDB search
MDSIIPAGVKLDDLQVILAKNENETRDKVCKQINEARDEILPLRLQFNEFIQIMANIDQE
GSKQADRMAKYLHIRDKILQLNDRFQTLSSHLEALQPLFSTVPEYLKTADNRDRSFQLLE
PLSTYNKNGNAVCSTATVVSTNHSAAASTPTTTATPHANPITHAHSLSNPNSTATMQHNP
LAGKRGPKSGSTMGTPTVHNSTAAAPIAAPKKPRKPRQTKKAKAQAQAQAQAQAQVYAQQ
STVQTPITASMAAALPNPTPSMINSVSPTNVMGTPLTNMMSPMGNAYSMGAQNQGGQVSM
SQFNGSGNGSNPNTNTNSNNTPLQSQLNLNNLTPANILNMSMNNDFQQQQQQQQQQQQPQ
PQYNMNMGMNNMNNGGKELDSLDLNNLELGGLNMDFL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggactcgattataccggcaggcgtcaagctagatgatttacaagtgatattggctaag
aacgagaatgaaaccagggacaaagtgtgtaagcagatcaacgaagcacgcgatgaaatt
ctgccgttgcgattgcagttcaatgaattcatacagataatggcaaacatagaccaagaa
ggatccaagcaggctgaccgtatggccaaatacctacatatcagagacaagattttgcaa
ctgaacgatagattccagactttgtcttcgcatttagaagcactgcaacctttattcagc
actgtaccagaatacttgaagactgcagataacagggacagaagtttccagcttttggaa
ccgttgagtacttataacaaaaatggcaacgccgtttgctcgacagcaactgttgtaagc
accaaccactctgcggccgcttcgacacccaccacaactgccacccctcatgcaaatccc
atcacacatgcgcactcgctttcgaatccaaatagcaccgctacaatgcaacataatccc
ctggccggcaagagaggtccaaaaagcggtagtactatgggaactccaaccgtacataat
agcactgcagctgcaccgattgcggcacctaaaaagccaagaaaaccaagacaaaccaag
aaggcaaaggctcaagctcaggctcaagcgcaggctcaagcgcaggtctacgcacagcag
tcgactgtccagacgccaataacagcatcgatggcagccgcgctacccaacccaactcct
agcatgattaacagcgtttcgcccacaaatgttatgggcacgccgctgaccaacatgatg
tctcccatggggaacgcatactcaatgggagctcaaaaccaagggggacaagtatctatg
tcacaattcaatggcagcggcaatggatccaatccaaatacaaatacaaactccaataac
accccgctacagtcacaattaaacctaaacaatctaacccctgctaatatcctaaatatg
agcatgaataacgatttccagcagcagcagcaacagcaacagcagcagcagcagcctcaa
ccacagtacaatatgaatatgggcatgaataacatgaataacggggggaaagaactggat
tctctagacctgaacaatctggaattaggtggtctgaacatggatttcttgtga

DBGET integrated database retrieval system