KEGG   Saccharomyces cerevisiae (budding yeast): YGL027CHelp
Entry
YGL027C           CDS       T00005                                 

Gene name
CWH41, DER7, GLS1
Definition
(RefSeq) Cwh41p
  KO
K01228  mannosyl-oligosaccharide glucosidase [EC:3.2.1.106]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00510  N-Glycan biosynthesis
sce01100  Metabolic pathways
sce04141  Protein processing in endoplasmic reticulum
Module
sce_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YGL027C (CWH41)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YGL027C (CWH41)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YGL027C (CWH41)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.106  mannosyl-oligosaccharide glucosidase
     YGL027C (CWH41)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YGL027C (CWH41)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_63 Glyco_hydro_63N FlaE
Motif
Other DBs
NCBI-GeneID: 852857
NCBI-ProteinID: NP_011488
SGD: S000002995
UniProt: P53008
Structure
PDB: 

Position
VII:complement(443642..446143)
Genome map
AA seq 833 aa AA seqDB search
MLISKSKMFKTFWILTSIVLLASATVDISKLQEFEEYQKFTNESLLWAPYRSNCYFGMRP
RYVHESPLIMGIMWFNSLSQDGLHSLRHFATPQDKLQKYGWEVYDPRIGGKEVFIDEKNN
LNLTVYFVKSKNGENWSVRVQGEPLDPKRPSTASVVLYFSQNGGEIDGKSSLAMIGHDGP
NDMKFFGYSKELGEYHLTVKDNFGHYFKNPEYETMEVAPGSDCSKTSHLSLQIPDKEVWK
ARDVFQSLVSDSIRDILEKEETKQRPADLIPSVLTIRNLYNFNPGNFHYIQKTFDLTKKD
GFQFDITYNKLGTTQSISTREQVTELITWSLNEINARFDKQFSFGEGPDSIESVEVKRRF
ALETLSNLLGGIGYFYGNQLIDRETEFDESQFTEIKLLNAKEEGPFELFTSVPSRGFFPR
GFYWDEGFHLLQIMEYDFDLAFEILASWFEMIEDDSGWIAREIILGNEARSKVPQEFQVQ
NPNIANPPTLLLAFSEMLSRAIENIGDFNSDSYHQVMFNSRTAKFMTNNLEANPGLLTEY
AKKIYPKLLKHYNWFRKSQTGLIDEYEEILEDEGIWDKIHKNEVYRWVGRTFTHCLPSGM
DDYPRAQPPDVAELNVDALAWVGVMTRSMKQIAHVLKLTQDEQRYAQIEQEVVENLDLLH
WSENDNCYCDISIDPEDDEIREFVCHEGYVSVLPFALKLIPKNSPKLEKVVALMSDPEKI
FSDYGLLSLSRQDDYFGKDENYWRGPIWMNINYLCLDAMRYYYPEVILDVAGEASNAKKL
YQSLKINLSNNIYKVWEEQGYCYENYSPIDGHGTGAEHFTGWTALVVNILGRF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgcttatttcaaaatctaagatgtttaaaacattttggatactaaccagcatagttctc
ctggcatctgccaccgttgatattagtaaactacaagaattcgaagaatatcaaaagttc
acgaatgaatctttactgtgggcaccgtatagatccaattgttactttggtatgaggccc
agatatgtccatgaaagtccactaattatgggtatcatgtggttcaacagtttgagtcag
gatggcttacattcgttaagacattttgcaacgcctcaggataaattgcaaaagtatggt
tgggaagtgtatgatccaagaattggtggtaaagaagtttttattgatgaaaaaaataac
ttgaacttgactgtttattttgtaaagagcaagaacggggaaaattggtcagtgagagtt
caaggtgagcctttggatcccaagagaccatctacagcatctgtcgtattgtactttagt
caaaatggtggcgagatagatggaaaatcttccttagcaatgataggtcatgacggccct
aatgacatgaaattcttcggatattctaaagaattaggcgagtatcatcttacagtaaag
gacaattttggtcactacttcaaaaatccggaatatgaaaccatggaagtagcaccagga
agtgactgctctaaaacaagtcatttatcacttcaaatcccggataaagaagtttggaag
gctcgtgatgttttccaatctctagttagcgattcgatacgtgatatactggaaaaggaa
gagacaaagcagcgtcctgctgatttaataccaagtgttttaactattagaaatttgtac
aattttaatcctggtaattttcattatatacaaaagacatttgatttgaccaaaaaagat
gggttccaatttgatatcacttacaataaacttggcactactcaaagtatttccaccagg
gaacaagttacggagttgattacttggtcactaaatgagataaacgcgcgttttgataag
cagtttagttttggagaaggtcccgactcaattgaaagcgtggaggtcaaaagaagattt
gctttagagacgctatcaaacctattaggaggaatcggttatttctatgggaatcaacta
attgatcgtgaaacagaatttgatgagagccagtttacagagatcaaactgctgaatgca
aaagaggaaggtccatttgaactgtttaccagcgttccgagccgtggctttttcccacgt
ggattctattgggatgaaggtttccatcttctacaaattatggagtatgattttgacctt
gcctttgaaatcttagcgagctggtttgaaatgatcgaagatgatagtggttggattgct
agagaaattatactgggtaatgaggcaaggagtaaagttccgcaggaatttcaggtgcaa
aatcccaatattgctaatccgccaactttattgctagcatttagtgaaatgctttctagg
gccattgaaaacatcggcgatttcaacagtgacagctaccaccaagtcatgttcaatagt
aggacagccaagtttatgacgaacaatctagaagccaatcctggcttgctaaccgaatat
gccaagaaaatttatcctaagctattgaagcactataattggttcagaaaatctcaaaca
ggacttattgatgaatatgaggaaatattggaagatgaaggaatatgggataagattcat
aagaacgaagtttatagatgggttgggcgtaccttcactcattgtttgccaagcggtatg
gatgactatcctagagcacaaccaccagatgtagcagaattgaacgtagacgcattagca
tgggtgggcgttatgacaagatccatgaagcaaattgctcacgtgttgaagttaacacag
gacgagcaaagatatgcacaaattgagcaagaggtggtcgagaatctggatttgttacac
tggagtgaaaatgacaattgctactgtgatattagcatcgatccagaagacgatgagatt
agggagtttgtatgtcatgagggttacgtctccgtattgccctttgcattgaagctaatc
cccaaaaactcacccaagctagagaaagtagttgctttgatgagtgacccagaaaaaatc
ttttcagactacgggctgttatcactatcgagacaagacgactatttcggcaaggatgaa
aactattggagaggcccaatttggatgaatattaattacttgtgtcttgacgcaatgaga
tactactacccagaggtgattctcgacgtggctggtgaggctagcaatgccaagaaactg
taccaaagtttaaagattaatctcagtaacaacatatacaaagtttgggaagaacaaggt
tattgttatgaaaattacagtccgatagatggtcatggtactggtgctgagcatttcaca
ggctggacagcacttgttgtcaacatccttggacgcttctga

DBGET integrated database retrieval system