KEGG   Saccharomyces cerevisiae (budding yeast): YGL030WHelp
Entry
YGL030W           CDS       T00005                                 

Gene name
RPL30
Definition
(RefSeq) ribosomal 60S subunit protein L30
  KO
K02908  large subunit ribosomal protein L30e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YGL030W (RPL30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YGL030W (RPL30)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YGL030W (RPL30)
  Archaea
    YGL030W (RPL30)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 852853
NCBI-ProteinID: NP_011485
SGD: S000002998
UniProt: P14120
Structure
PDB: 

Position
VII:join(439091..439093,439324..439638)
Genome map
AA seq 105 aa AA seqDB search
MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYA
MLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggccccagttaaatcccaagaatctatcaaccaaaagttggctttggttatcaagtct
ggtaagtacaccttaggttacaagtccactgtcaagtctttgagacaaggtaagtctaag
ttgatcatcattgccgctaacactccagttttgagaaagtccgaattggaatattacgct
atgttgtccaagactaaggtctactacttccaaggtggtaacaacgaattgggtactgct
gtcggtaagttattcagagtcggtgttgtctctattttggaagctggtgactctgatatc
ttgaccaccttggcttaa

DBGET integrated database retrieval system