KEGG   Saccharomyces cerevisiae (budding yeast): YGL031CHelp
Entry
YGL031C           CDS       T00005                                 

Gene name
RPL24A, RPL30A
Definition
(RefSeq) ribosomal 60S subunit protein L24A
  KO
K02896  large subunit ribosomal protein L24e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YGL031C (RPL24A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YGL031C (RPL24A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YGL031C (RPL24A)
  Archaea
    YGL031C (RPL24A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L24e
Motif
Other DBs
NCBI-GeneID: 852852
NCBI-ProteinID: NP_011484
SGD: S000002999
UniProt: P04449
Structure
PDB: 

Position
VII:complement(437467..437934)
Genome map
AA seq 155 aa AA seqDB search
MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHK
KGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEVRKANREEKLKANKEKKKAEK
AARKAEKAKSAGTQSSKFSKQQAKGAFQKVAATSR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgaaatcgattctttttcaggtgccaaaatctacccaggcagaggtaccttg
tttgtccgtggtgactccaaaatcttcagattccaaaactccaaatctgcctctttgttc
aagcaaagaaagaacccaagaagaatcgcttggactgtcttattcagaaagcatcacaag
aagggtatcaccgaagaagttgctaagaagagatctagaaaaaccgttaaggcccaaaga
ccaattaccggtgcttctttggacttgatcaaggaaagaagatctttgaagccagaagtt
agaaaggctaacagagaagaaaaattgaaggccaacaaagaaaagaagaaggctgaaaag
gctgctagaaaggctgaaaaggctaagtctgctggtactcaaagttctaagttctccaag
caacaagctaagggtgctttccaaaaggttgctgctacttctcgttaa

DBGET integrated database retrieval system