KEGG   Saccharomyces cerevisiae (budding yeast): YGL032CHelp
Entry
YGL032C           CDS       T00005                                 

Gene name
AGA2
Definition
(RefSeq) Aga2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AGA2
Motif
Other DBs
NCBI-GeneID: 852851
NCBI-ProteinID: NP_011483
SGD: S000003000
UniProt: P32781
Position
VII:complement(436570..436833)
Genome map
AA seq 87 aa AA seqDB search
MQLLRCFSIFSVIASVLAQELTTICEQIPSPTLESTPYSLSTTTILANGKAMQGVFEYYK
SVTFVSNCGSHPSTTSKGSPINTQYVF
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgcagttacttcgctgtttttcaatattttctgttattgcttcagttttagcacaggaa
ctgacaactatatgcgagcaaatcccctcaccaactttagaatcgacgccgtactctttg
tcaacgactactattttggccaacgggaaggcaatgcaaggagtttttgaatattacaaa
tcagtaacgtttgtcagtaattgcggttctcacccctcaacaactagcaaaggcagcccc
ataaacacacagtatgttttttga

DBGET integrated database retrieval system