KEGG   Saccharomyces cerevisiae (budding yeast): YGL035CHelp
Entry
YGL035C           CDS       T00005                                 

Gene name
MIG1, CAT4, SSN1, TDS22
Definition
(RefSeq) transcription factor MIG1
  KO
K09467  zinc-finger protein CreA/MIG
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YGL035C (MIG1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 metabolic regulators in fungi
    YGL035C (MIG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3748 GAGA
Motif
Other DBs
NCBI-GeneID: 852848
NCBI-ProteinID: NP_011480
SGD: S000003003
UniProt: P27705
Position
VII:complement(431548..433062)
Genome map
AA seq 504 aa AA seqDB search
MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMRIH
TGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRGRKKKVVGSPINSASSSATSI
PDLNTANFSPPLPQQHLSPLIPIAIAPKENSSRSSTRKGRKTKFEIGESGGNDPYMVSSP
KTMAKIPVSVKPPPSLALNNMNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIAS
SAPRTVFIDGPEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT
QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSSIDNLEQDYLQ
EQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFSSSSPDFQKELNNRLLNVQQQ
QQEQHTLLQSQNTSNQSQNQNQNQMMASSSSLSTTPLLLSPRVNMINTAISTQQTPISQS
DSQVQELETLPPIRSLPLPFPHMD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcccatatccaatgacacaagtgtctaacgttgatgatgggtcactattgaag
gagagtaaaagcaagtccaaagtagctgcgaagtcagaggcgccaagaccacatgcttgt
cctatctgtcatagagcttttcacagactggaacatcagacgagacacatgagaattcat
acaggtgagaagcctcacgcgtgtgacttccccggatgtgtgaaaaggttcagtagaagc
gatgaactgacgagacacagaagaattcatacaaactcccaccctcgaggtaaaagaggc
agaaagaagaaggttgtgggctctccaataaatagtgctagttctagtgctaccagtata
ccagatttaaatacggcaaatttttcaccgccattaccacagcaacacctatcgccttta
attcctattgctattgctccgaaagaaaattcaagtcgatcttctacaagaaaaggtaga
aaaaccaaattcgaaatcggcgaaagtggtgggaatgacccatatatggtttcttctccc
aaaacgatggctaagattcccgtctcggtgaagcctccaccttctttagcactgaataat
atgaactaccaaacttcatccgcttccactgctttgtcttcgttgagcaatagccatagt
ggcagtagactgaaactgaacgcgttatcgtccctacaaatgatgacgcccattgctagc
agtgcgccaaggactgttttcatagacggtcctgaacagaaacaactacaacaacaacaa
aattctctttcaccacgttattccaacactgttatattaccaaggccgcgatctttaacg
gattttcaaggattgaacaatgcaaatccaaacaacaatggaagtctcagagcacaaact
cagagttccgtacagttgaagagaccaagttcagttttaagtttgaacgacttgttggtt
ggccaaagaaataccaacgaatctgactctgattttactactggtggtgaggatgaagaa
gacggactaaaggacccgtctaactctagtatcgataaccttgagcaagactatttgcaa
gagcaatcaagaaagaaatctaagacttccacgcccacgacaatgctaagtagatccact
agtggtacgaatttgcacactttggggtatgtaatgaaccaaaatcacttgcatttctcc
tcatcatctcctgatttccaaaaggagttgaacaacagattactgaacgttcaacaacag
cagcaagagcaacataccctactgcaatcacaaaatacgtcaaaccaaagtcaaaatcaa
aatcaaaatcaaatgatggcttccagtagttcgttaagtacaaccccgttattattgtca
ccaagggtgaatatgattaatactgctatatccacccaacaaacccccatttctcagtcg
gattcacaagttcaagaactggaaacattaccacccataagaagtttaccgttgcccttc
ccacacatggactga

DBGET integrated database retrieval system