KEGG   Saccharomyces cerevisiae (budding yeast): YGL038CHelp
Entry
YGL038C           CDS       T00005                                 

Gene name
OCH1, LDB12, NGD29
Definition
(RefSeq) Och1p
  KO
K05528  alpha 1,6-mannosyltransferase [EC:2.4.1.232]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00513  Various types of N-glycan biosynthesis
sce01100  Metabolic pathways
Module
sce_M00074  N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    YGL038C (OCH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YGL038C (OCH1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.232  initiation-specific alpha-1,6-mannosyltransferase
     YGL038C (OCH1)
Glycosyltransferases [BR:sce01003]
 Glycan extension
  Yeast mannan chain
   YGL038C (OCH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_transf_sug Caps_synth
Motif
Other DBs
NCBI-GeneID: 852845
NCBI-ProteinID: NP_011477
SGD: S000003006
UniProt: P31755
Position
VII:complement(425362..426804)
Genome map
AA seq 480 aa AA seqDB search
MSRKLSHLIATRKSKTIVVTVLLIYSLLTFHLSNKRLLSQFYPSKDDFKQTLLPTTSHSQ
DINLKKQITVNKKKNQLHNLRDQLSFAFPYDSQAPIPQRVWQTWKVGADDKNFPSSFRTY
QKTWSGSYSPDYQYSLISDDSIIPFLENLYAPVPIVIQAFKLMPGNILKADFLRYLLLFA
RGGIYSDMDTMLLKPIDSWPSQNKSWLNNIIDLNKPIPYKNSKPSLLSSDEISHQPGLVI
GIEADPDRDDWSEWYARRIQFCQWTIQAKPGHPILRELILNITATTLASVQNPGVPVSEM
IDPRFEEDYNVNYRHKRRHDETYKHSELKNNKNVDGSDIMNWTGPGIFSDIIFEYMNNVL
RYNSDILLINPNLNKNDEEGSESATTPAKDVDNDTLSKSTRKFYKKISESLQSSNSMPWE
FFSFLKEPVIVDDVMVLPITSFSPDVGQMGAQSSDDKMAFVKHMFSGSWKEDADKNAGHK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggaagttgtcccacctgatcgctacaaggaaatcaaaaacaatagtcgtaacc
gtacttcttatttattctttgttgacatttcacttgtcaaacaaaaggctgctttctcag
ttttaccctagcaaagatgatttcaagcaaactcttctccctacgacttctcattcacaa
gatataaatttgaagaaacaaattacagttaacaagaaaaaaaatcaattgcataattta
cgtgatcaattatcgtttgcgtttccctacgactctcaggcccccatcccgcaaagggtg
tggcagacctggaaagtcggcgcagatgataagaattttccctcttcgttcagaacctat
caaaaaacatggtctggttcgtattcaccggattaccaatattctctgatttcggatgat
tctattatcccttttttggagaatctttacgcacccgttccgatagtcatccaagcgttt
aaattgatgcctggaaatatcctaaaggcagattttttaaggtacctattattatttgca
agaggtggtatttactcagatatggatactatgcttttgaagccaattgattcatggcct
tctcagaataagtcatggctaaacaacataatagatttgaataaacctattccttataag
aactcaaagccctcacttctctcaagtgatgagatatcacaccagccaggtttggtcatc
ggcattgaggcagatccggacagagatgattggagtgaatggtatgctcgtaggatccag
ttttgtcaatggactatccaagccaaaccaggtcacccaattctaagagaattgatctta
aatattactgcaacgactttggcgagcgtacaaaacccaggagttcctgtcagtgaaatg
attgatccaagatttgaagaagactacaacgtaaactataggcacaaaagacgtcatgat
gagacctacaaacactccgaattgaaaaataacaaaaatgttgatggctcagatataatg
aattggacgggtccaggtattttctccgacattattttcgaatacatgaacaatgtgctc
cgatacaatagcgatatcttgttaatcaacccaaacctaaacaagaacgacgaagaaggt
agtgagagtgccaccacaccagcaaaagatgttgataacgatacgctgtccaaatcaaca
agaaaattttataagaaaatatcagagtctttgcaatcgtcaaattcaatgccctgggaa
ttcttctcttttttgaaagaaccagttatcgttgatgatgtgatggttctaccaataaca
agtttttcaccagatgtggggcagatgggcgcccagtctagtgacgacaaaatggctttt
gtaaagcacatgtttagcgggagctggaaagaagatgctgataaaaatgcaggtcataaa
taa

DBGET integrated database retrieval system