KEGG   Saccharomyces cerevisiae (budding yeast): YGL039WHelp
Entry
YGL039W           CDS       T00005                                 

Definition
(RefSeq) carbonyl reductase (NADPH-dependent)
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 GDP_Man_Dehyd KR adh_short NAD_binding_10 Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-GeneID: 852844
NCBI-ProteinID: NP_011476
SGD: S000003007
UniProt: P53183
Position
VII:423961..425007
Genome map
AA seq 348 aa AA seqDB search
MTTEKTVVFVSGATGFIALHVVDDLLKTGYKVIGSGRSQEKNDGLLKKFKSNPNLSMEIV
EDIAAPNAFDKVFQKHGKEIKVVLHIASPVHFNTTDFEKDLLIPAVNGTKSILEAIKNYA
ADTVEKVVITSSVAALASPGDMKDTSFVVNEESWNKDTWESCQANAVSAYCGSKKFAEKT
AWDFLEENQSSIKFTLSTINPGFVFGPQLFADSLRNGINSSSAIIANLVSYKLGDNFYNY
SGPFIDVRDVSKAHLLAFEKPECAGQRLFLCEDMFCSQEALDILNEEFPQLKGKIATGEP
GSGSTFLTKNCCKCDNRKTKNLLGFQFNKFRDCIVDTASQLLEVQSKS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgactactgaaaaaaccgttgtttttgtttctggtgctactggtttcattgctctacac
gtagtggacgatttattaaaaactggttacaaggtcatcggttcgggtaggtcccaagaa
aagaatgatggattgctgaaaaaatttaagagcaatcccaacctttcaatggagattgtc
gaagacattgctgctccaaacgcttttgacaaagtttttcaaaagcacggcaaagagatc
aaggttgtcttgcacatagcttctccggttcacttcaacaccactgatttcgaaaaggat
ctgctaattcctgctgtgaatggtaccaagtccattctagaagcaatcaaaaattatgcc
gcagacacagtcgaaaaagtcgttattacttcttctgttgctgcccttgcatctcccgga
gatatgaaggacactagtttcgttgtcaatgaggaaagttggaacaaagatacttgggaa
agttgtcaagctaacgcggtttccgcatactgtggttccaagaaatttgctgaaaaaact
gcttgggattttctcgaggaaaaccaatcaagcatcaaatttacgctatcaaccatcaac
ccaggatttgtttttggccctcagctatttgccgactctcttagaaatggaataaatagc
tcttcagccattattgccaatttggttagttataaattaggcgacaatttttataattac
agtggtccttttattgacgttcgcgatgtttcaaaagctcatttacttgcatttgagaaa
cccgaatgcgctggccaaagactattcttatgtgaagatatgttttgctctcaagaagcg
ctggatatcttgaatgaggaatttccacagttaaaaggcaagatagcaactggcgaacct
ggtagcggctcaacctttttgacaaaaaactgctgcaagtgcgacaaccgcaaaaccaaa
aatttattaggattccaatttaataagttcagagattgcattgtcgatactgcctcgcaa
ttactagaagttcaaagtaaaagctaa

DBGET integrated database retrieval system