KEGG   Saccharomyces cerevisiae (budding yeast): YGL086W
Entry
YGL086W           CDS       T00005                                 

Gene name
MAD1
Definition
(RefSeq) coiled-coil domain-containing protein MAD1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGL086W (MAD1)
   04113 Meiosis - yeast
    YGL086W (MAD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YGL086W (MAD1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     YGL086W (MAD1)
SSDB
Motif
Pfam: MAD
Other DBs
NCBI-GeneID: 852794
NCBI-ProteinID: NP_011429
SGD: S000003054
UniProt: P40957
Position
VII:347119..349368
AA seq 749 aa
MDVRAALQCFFSALSGRFTGKKLGLEIYSIQYKMSNSGGSSPFLESPGGSPDVGSTNGQS
NRQIQALQFKLNTLQNEYEIEKLQLQKQTNILEKKYKATIDELEKALNDTKYLYESNDKL
EQELKSLKERSANSMNDKDKCIEELRTTLQNKDLEMETLRQQYDSKLSKVTNQCDHFKLE
AESSHSLLMKYEKEIKRQSVDIKDLQHQVMEKDDELSSVKASKMINSHPNYSTEEFNELT
EMNKMIQDQVQYTKELELANMQQANELKKLKQSQDTSTFWKLENEKLQNKLSQLHVLESQ
YENLQLENIDLKSKLTKWEIYNDSDDDDDNNVNNNDNNNNNKNDNNNDNNNDTSNNNNIN
NNNRTKNNIRNNPEEIIRDWKLTKKECLILTDMNDKLRLDNNNLKLLNDEMALERNQILD
LNKNYENNIVNLKRLNHELEQQKSLSFEECRLLREQLDGLYSAQNNALLEVENSETHASN
KNVNEDMNNLIDTYKNKTEDLTNELKKLNDQLLSNSNDVETQRKKRKLTSDQIGLNYSQR
LNELQLENVSVSRELSKAQTTIQLLQEKLEKLTKLKEKKIRILQLRDGPFIKDQFIKKNK
LLLLEKENADLLNELKKNNPAVETVPISVYDSLNFELKQFEQEVFKSNKRFSRLKQVFNN
KSLEFIDVVNSLLGFKLEFQQDSRVKIFSCFKPEKYLIADLNENTLKSNLDADIEGWDDL
MNLWVEDRGQLPCFLATITLRLWEQRQAK
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggatgtgagagcggcattgcaatgtttcttcagtgcattgagtggacgattcactgga
aaaaaattgggactagagatctattctatccagtacaaaatgagcaatagtggtgggtcc
tctcctttcttggaaagccctggaggttcgcccgacgtaggcagtacaaatggacaaagt
aatcgtcagattcaggcgttacaattcaagctcaatactctacaaaatgagtatgagatt
gaaaaattgcagctacaaaaacagacgaatatcttagaaaagaaatataaggccacgatt
gacgaattagagaaagcattgaatgatacaaaatatctttatgaaagcaatgataaattg
gagcaagagttaaagagtttgaaagaaagatcagctaattcgatgaatgataaagacaaa
tgcatagaggaattgcgaacaaccctccaaaacaaagatttagaaatggagactttaagg
cagcagtatgattcgaagttatcaaaggtcactaaccaatgtgaccatttcaagttggaa
gcagagagctctcattcgctactgatgaaatatgagaaagaaataaagaggcaaagtgtg
gatatcaaagatttgcagcatcaagtgatggaaaaggatgatgaattatcttcggtaaaa
gcatctaagatgataaactcacatccaaactactccaccgaagagttcaacgagctcact
gaaatgaacaaaatgatccaagaccaagttcagtatactaaagaattggaactagcgaac
atgcaacaagccaatgaattgaaaaaacttaaacaatcccaggacacttctactttttgg
aaattagaaaatgaaaaactacaaaacaaattaagtcaattacacgtactcgaaagtcaa
tatgaaaatcttcaattggaaaacatagatctaaaatcgaaattaaccaaatgggaaatt
tataatgatagtgacgatgatgatgataacaatgttaacaacaatgataataataataat
aataaaaatgataataataatgataataataatgatacaagtaataacaacaatattaat
aataacaacagaaccaaaaataacataagaaataaccctgaagagattatccgggactgg
aaacttaccaaaaaggaatgtttaattttgacagatatgaatgataagttaagattggac
aataacaatttaaagctactgaatgatgaaatggctttagagagaaaccaaatactagat
ttgaacaagaattatgaaaacaacatagtaaatttgaaaagattaaatcacgagttagaa
caacagaagagtttatctttcgaagaatgtcgattactgcgcgaacaattagatggccta
tattccgcacaaaataatgctttactagaggtcgaaaatagtgaaacacatgcgtcaaac
aagaacgtaaacgaagatatgaataatttgatcgatacttataaaaataagacagaagat
ttaacaaacgaactaaagaagctaaacgatcagttattatcaaattccaatgatgtagaa
acacaaagaaaaaagaggaagttgacaagtgaccaaattggtttaaattattcacagagg
ctcaacgaattgcaactggaaaatgtaagtgtctcgagggagttgagtaaagcacaaact
acaattcagctactacaagaaaaattagaaaagttaactaaactaaaggagaaaaaaata
cgtatactgcaattacgtgacggccccttcataaaagatcaatttatcaagaaaaacaaa
ttacttcttctagaaaaggaaaatgcagatttacttaacgaattgaaaaagaataatcca
gcagtggaaacagtacccatttctgtttatgattcactaaatttcgagttgaaacagttc
gaacaggaagtttttaagtcaaataaaagattttccagactaaagcaagttttcaataat
aaatctttggagtttattgacgttgtaaactcattattaggttttaaattggaatttcaa
caagatagtcgtgtgaaaatattttcctgtttcaaacctgaaaaatatttgattgctgat
ctaaatgaaaacactttgaaatctaaccttgatgcagatatagaaggatgggatgatctc
atgaatctatgggtggaagatagaggtcaacttccgtgctttttggcaacaataacattg
cgtctgtgggaacagcgacaagccaaataa

DBGET integrated database retrieval system