KEGG   Saccharomyces cerevisiae (budding yeast): YGL112C
Entry
YGL112C           CDS       T00005                                 

Gene name
TAF6, TAF60
Definition
(RefSeq) TATA-binding protein-associated factor TAF6
  KO
K03131  transcription initiation factor TFIID subunit 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YGL112C (TAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YGL112C (TAF6)
   03036 Chromosome and associated proteins [BR:sce03036]
    YGL112C (TAF6)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     YGL112C (TAF6)
   Coactivators
    SAGA/TFTC/STAGA complex
     YGL112C (TAF6)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     YGL112C (TAF6)
    STAGA complex
     YGL112C (TAF6)
    TFTC complex
     YGL112C (TAF6)
    SAGA complex
     YGL112C (TAF6)
    SLIK complex
     YGL112C (TAF6)
SSDB
Motif
Pfam: TAF6_C TAF Histone TAF4 TFIID-31kDa DUF348 CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 852766
NCBI-ProteinID: NP_011403
SGD: S000003080
UniProt: P53040
Position
VII:complement(298178..299728)
AA seq 516 aa
MSTQQQSYTIWSPQDTVKDVAESLGLENINDDVLKALAMDVEYRILEIIEQAVKFKRHSK
RDVLTTDDVSKALRVLNVEPLYGYYDGSEVNKAVSFSKVNTSGGQSVYYLDEEEVDFDRL
INEPLPQVPRLPTFTTHWLAVEGVQPAIIQNPNLNDIRVSQPPFIRGAIVTALNDNSLQT
PVTSTTASASVTDTGASQHLSNVKPGQNTEVKPLVKHVLSKELQIYFNKVISTLTAKSQA
DEAAQHMKQAALTSLRTDSGLHQLVPYFIQFIAEQITQNLSDLQLLTTILEMIYSLLSNT
SIFLDPYIHSLMPSILTLLLAKKLGGSPKDDSPQEIHEFLERTNALRDFAASLLDYVLKK
FPQAYKSLKPRVTRTLLKTFLDINRVFGTYYGCLKGVSVLEGESIRFFLGNLNNWARLVF
NESGITLDNIEEHLNDDSNPTRTKFTKEETQILVDTVISALLVLKKDLPDLYEGKGEKVT
DEDKEKLLERCGVTIGFHILKRDDAKELISAIFFGE
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgtctacacagcagcaatcttacacaatttggtctccacaagatactgttaaagatgtc
gctgagtcgcttgggttggaaaatatcaacgatgacgtgttgaaagcacttgctatggac
gttgaataccgtattctagagattattgaacaggcagtcaagtttaaaagacactctaaa
agagatgttttaactacagacgatgtatcgaaggccctgcgtgttctgaatgtggaacct
ttatatggatattatgatggctctgaagttaataaagctgtatcatttagtaaggttaac
acaagtggaggacagtcggtttactacctggatgaggaagaagtagattttgatagatta
ataaatgagccattaccgcaagtgcctcgtctaccaacttttactacacattggctagca
gttgaaggggttcaacctgccataatccaaaatccaaatttgaatgatataagggtatcc
caaccaccatttattagaggtgctattgtcactgctttgaatgataacagcctccaaaca
cctgtaacgtcgacgacagcaagtgcttctgtgacggatacaggcgcctctcaacacctg
tctaatgttaaaccaggacagaatactgaagtcaaacctttagtgaaacacgttttatcc
aaagaattacagatttatttcaataaggtcatttcaaccttgacagcgaagagtcaagct
gatgaagctgcacagcatatgaaacaagcagctttgacttcactacgaactgatagtggc
ctgcaccaactggttccatattttattcaatttattgccgaacaaatcacacaaaatctt
tccgatttacaattgctaacaacaattttggaaatgatttactctttactaagcaatact
tctattttcctggacccttatattcattcgttaatgccttccattttaaccttgctatta
gcaaaaaaacttggtggatcaccaaaagatgattcgccgcaagaaattcatgaattttta
gaaagaacgaatgcactacgtgattttgccgcatctttgttggactatgtattgaaaaaa
tttcctcaagcatacaaatccctgaagccaagagtaactaggacactgctaaagacattt
ttggacataaaccgtgtttttgggacttactatgggtgcttaaagggtgtatcggtacta
gaaggtgaatccatcagattcttcttaggaaacctaaataattgggcgcgcttggtattc
aatgaaagcggaataactctagacaatatagaggaacatttgaacgatgactccaatcca
actaggaccaaatttactaaagaagaaactcaaatcttggttgatactgtaattagtgca
ttgttagttctaaaaaaggatttaccagatttgtacgagggtaaaggtgaaaaagttacg
gatgaggataaggaaaaattgctagagaggtgtggtgtcactattggatttcacattttg
aaaagagacgacgcaaaagaattaattagtgcgatattttttggcgaatag

DBGET integrated database retrieval system