KEGG   Saccharomyces cerevisiae (budding yeast): YGL119WHelp
Entry
YGL119W           CDS       T00005                                 

Gene name
COQ8, ABC1
Definition
(RefSeq) protein kinase COQ8
  KO
K08869  aarF domain-containing kinase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YGL119W (COQ8)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  ABC1 family
   YGL119W (COQ8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC1
Motif
Other DBs
NCBI-GeneID: 852758
NCBI-ProteinID: NP_011396
SGD: S000003087
UniProt: P27697
Position
VII:284442..285947
Genome map
AA seq 501 aa AA seqDB search
MVTNMVKLRNLRRLYCSSRLLRTIQNGRISSVSSISLSKKYTTKSAKEGEENVERKHEEE
KKDTLKSSSVPTSRISRLFHYGSLAAGVGMNAAAKGISEVAKGNSPTWKSLILSDSNIDR
ITNKFSKMRGVALKIGQLLSFQDEKVLPKELYEILSRVQNSANHMPQRQLEKVMAKELGA
NWKTKFSKFDKIPMAAASIGQVHAAELPSGQRVVVKIQYPGVKESIDSDLNSLLMLLTAS
SLLPKGLFLDKTIANARTELKWECDYNREARALQKFEALLKDDPAFEVPHVFPEYTTDNI
ITMTRMEGTEIMKLPKASQETKNFISENIMRLCLEEIATFKYMQTDPNWANFLYNGRTKK
IELLDFGASRPFAEDFILKYRKLLTYATLRDRKGAYEMSVQLGYLTGLESQSMKDAHVDS
VLTLGEPFRGDVDKSFDFKDQTVSDRIRGNIGLMLNERLCPPPEETYSLHRKFSGIFLLC
ARMGASVHCAKLFKEIFAYKV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatatggtgaaattgaggaatttaaggagattgtattgttcatcccgtctc
ttaagaactatacagaacgggagaatttcttctgtttcttcaatatcgttgagtaagaaa
tatactacaaaatctgccaaagaaggtgaagaaaacgtagaaaggaagcatgaggaggaa
aaaaaggatacattaaaaagttccagtgtaccaacttcacgaatatcgagattgttccat
tatggctcactggcagcaggggtgggcatgaatgccgcagcaaaaggcatatcggaagtt
gcaaagggcaattctcccacttggaaatctttgattctatcagattcgaatattgacaga
attaccaataaattttctaaaatgagaggtgttgcccttaaaatagggcaactattgtct
tttcaggatgagaaagtgttgccaaaggaattatacgaaattttatcaagggtacagaat
agtgcaaatcatatgcctcaaaggcaattggaaaaggttatggccaaggaattaggtgct
aattggaagacaaagttttccaaatttgacaagatacctatggcagctgctagtatcgga
caggtacatgcggcagagttgcccagtggtcaaagagtggttgtcaaaattcaatatcct
ggggttaaagaatccattgattcggatttgaatagtttactaatgttacttacagcctca
agtttattaccgaagggattatttttggataagacaattgccaacgctagaactgagtta
aaatgggaatgtgattacaacagagaggctagagctctacaaaagtttgaggcgttgcta
aaggatgacccagcgtttgaggttcctcatgtgtttcctgaatatacaaccgataatatt
ataactatgacacgtatggagggaactgaaataatgaaattgcccaaggcatcacaagaa
accaaaaattttatttcggagaatatcatgagactatgtctggaagaaattgccactttc
aagtatatgcaaacggatcctaattgggcaaatttcctctataacggtaggacaaagaaa
attgaattattggatttcggtgcctccagaccttttgcagaagattttattctaaaatat
agaaaacttttaacttacgccacattgagagataggaaaggggcgtacgaaatgtctgta
caactgggctatctcacaggcttagaatcgcagtccatgaaagacgcgcacgtcgatagt
gtacttacacttggtgaaccttttaggggtgatgtagataaatctttcgatttcaaggat
caaacagtctcagacaggattagaggtaatatcgggttaatgttgaatgaaagactatgt
ccgccaccagaggaaacatactcgttacatagaaaatttagtggcatttttcttttgtgt
gcaagaatgggtgcgtctgttcattgtgcaaagctttttaaagagatttttgcctataaa
gtttaa

DBGET integrated database retrieval system