KEGG   Saccharomyces cerevisiae (budding yeast): YGL150CHelp
Entry
YGL150C           CDS       T00005                                 

Gene name
INO80
Definition
(RefSeq) chromatin-remodeling ATPase INO80
  KO
K11665  DNA helicase INO80 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YGL150C (INO80)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YGL150C (INO80)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   INO80 complex
    YGL150C (INO80)
   INO80 complex (yeast)
    YGL150C (INO80)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N DBINO Helicase_C DEAD Fe_hyd_lg_C
Motif
Other DBs
NCBI-GeneID: 852728
NCBI-ProteinID: NP_011365
SGD: S000003118
UniProt: P53115
Structure
PDB: 

Position
VII:complement(221104..225573)
Genome map
AA seq 1489 aa AA seqDB search
MSLAVLLNKEDKDISDFSKTTAGKSAKKNSRERVADVAPTRVLDKKQAYLSQLNSEFNRI
KRRDSIEQLYQDWKFINLQEFELISEWNQQSKDWQFDNTNDSQDLHFKKLYRDMSMINKE
WAEYQSFKNANLSDIINEKDADEDEEDDEDELEDGEEDMEEDEASTGRHTNGKSMRGNGI
QKSRKKDAAAAAAIGKAIKDDQTHADTVVTVNGDENEDGNNGEDEDNDNDNENNNDNDND
NENENDNDSDNDDEEENGEEDEEEEEIEDLDEEDFAAFEEQDDNDDEDFNPDVEKRRKRS
SSSSSSTKLSMNSLSLITSKKINKNITINSDRPKIVRELIKMCNKNKHQKIKKRRFTNCI
VTDYNPIDSKLNIKITLKQYHVKRLKKLINDAKREREREEALKNNVGLDGNDLDNDEDGS
ESHKRRKLNNNTANGADDANKRKFNTRHGLPTYGMKMNAKEARAIQRHYDNTYTTIWKDM
ARKDSTKMSRLVQQIQSIRSTNFRKTSSLCAREAKKWQSKNFKQIKDFQTRARRGIREMS
NFWKKNEREERDLKKKIEKEAMEQAKKEEEEKESKRQAKKLNFLLTQTELYSHFIGRKIK
TNELEGNNVSSNDSESQKNIDISALAPNKNDFHAIDFDNENDEQLRLRAAENASNALAET
RAKAKQFDDHANAHEEEEEEDELNFQNPTSLGEITIEQPKILACTLKEYQLKGLNWLANL
YDQGINGILADEMGLGKTVQSISVLAHLAENHNIWGPFLVVTPASTLHNWVNEISKFLPQ
FKILPYWGNANDRKVLRKFWDRKNLRYNKNAPFHVMVTSYQMVVTDANYLQKMKWQYMIL
DEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSHDEFNE
WFSKDIESHAEANTKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQ
AKLYQVLKSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQFRKVCNHPDLFERA
DVDSPFSFTTFGKTTSMLTASVANNNSSVISNSNMNLSSMSSNNISNGKFTDLIYSSRNP
IKYSLPRLIYEDLILPNYNNDVDIANKLKNVKFNIFNPSTNYELCLFLSKLTGEPSLNEF
FRVSTTPLLKRVIERTNGPKNTDSLSFKTITQELLEVTRNAPSEGVMASLLNVEKHAYER
EYLNCIQRGYHPNVSAPPVTIEVLGSSHVTNSINNELFDPLISQALSDIPAITQYNMHVK
KGIPVEDFPKTGLFPEPLNKNFSSNISMPSMDRFITESAKLRKLDELLVKLKSEGHRVLI
YFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLVHDWQTNPEIFVFLLSTRAGGLG
INLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVRGTIEERMRDRAKQKE
QVQQVVMEGKTQEKNIKTIEVGENDSEVTREGSKSISQDGIKEAASALA
NT seq 4470 nt NT seq  +upstreamnt  +downstreamnt
atgtcactggcagttctactcaataaggaggacaaggatatatctgatttttcaaagact
accgcaggcaagtctgctaagaagaatagcagagagagagttgccgatgtggcgcccacc
agagtgctagataagaaacaagcgtatctatctcaactgaacagtgagttcaaccgtatc
aagagaagggattcgatagagcaactttatcaggactggaaatttatcaatctacaagag
ttcgagttgatatcggaatggaatcaacaatccaaggattggcaatttgataacactaat
gattctcaggacctgcattttaaaaaactgtaccgtgatatgagcatgatcaataaagaa
tgggcggaataccaatcttttaaaaatgcaaatttatcggacataatcaatgaaaaggac
gctgacgaggatgaagaagatgatgaagacgagcttgaagatggtgaagaagacatggaa
gaagatgaggcaagtactggtaggcataccaatgggaagagcatgcgtgggaatggtatt
caaaaatcgagaaagaaggatgctgctgctgctgccgctattgggaaagccataaaggat
gatcaaactcatgccgatactgttgttactgttaatggagacgaaaacgaggatggcaat
aacggtgaagacgaagacaacgacaacgacaatgaaaacaacaacgacaacgacaacgac
aacgaaaatgaaaatgacaatgacagtgacaatgatgacgaggaagaaaatggagaggag
gacgaagaggaagaggaaatcgaggatcttgatgaagaagatttcgccgcctttgaagaa
caggatgacaatgacgatgaggactttaatcccgatgtcgagaaaaggagaaagagatct
tcctcttcttcttcatccaccaaactatctatgaactcgctgtctttaataacgtccaag
aaaataaataaaaatattaccatcaacagtgataggccgaagattgtacgtgaacttatc
aaaatgtgcaacaaaaacaagcatcagaagattaagaagaggaggttcaccaattgtatt
gtcaccgactacaatccaatcgattccaagttgaacatcaaaataactttgaaacagtac
cacgtcaaaaggttgaaaaaactgattaacgatgcgaagagagaaagagaaagggaagag
gccttgaagaacaacgttggtttggatggtaatgatttggataatgatgaggatggatct
gaatcccacaagagaaggaaattaaacaataatactgctaacggtgccgatgatgctaat
aagagaaaattcaacactagacacgggttgcccacttacggcatgaaaatgaatgctaag
gaagcccgtgctatccagaggcattacgacaacacctatacaactatttggaaagacatg
gctcgtaaggattctacgaaaatgtcaagattggttcagcaaatacaatcaatcagatct
acaaattttaggaaaacttcctcactttgtgctagagaagccaagaaatggcaatccaag
aacttcaaacaaataaaggacttccaaacgagggccagaagaggtattagggaaatgtcc
aatttttggaagaagaatgagcgtgaagaaagagatctaaagaagaagatagaaaaggag
gctatggaacaggcaaagaaggaagaagaggagaaggaatccaaaagacaagctaaaaag
ctgaactttttgttaacacagacagaattgtattcgcatttcattggaaggaaaatcaaa
actaacgaattggaagggaacaatgtttccagtaatgattctgaaagccagaagaatatt
gacatttcagctttggctccaaataaaaatgactttcacgccattgactttgataacgaa
aatgacgaacaattgagactaagagctgctgaaaatgcttccaatgcactggcagaaaca
agagcgaaagcgaaacaatttgatgatcatgccaatgcgcatgaggaagaagaggaggaa
gatgagttgaacttccaaaacccaacctctttaggtgaaataaccatcgagcaaccaaag
attttggcatgtactttgaaagaatatcagctcaagggtttgaattggctagctaacctt
tacgaccagggtatcaatggtatcttagcagatgaaatggggttaggtaaaactgtgcaa
tctatttccgttttggctcatctagccgagaaccataatatttgggggccctttttggtg
gtcacacccgcttctactctgcataactgggtcaatgaaatatccaaatttttgcctcaa
tttaaaattctgccatactggggtaatgccaatgaccgtaaagttcttaggaaattttgg
gacaggaaaaatctgaggtataataagaatgcgccattccatgtcatggttacatcctat
caaatggttgtcactgatgctaactatttgcagaaaatgaaatggcaatatatgatactg
gatgaggcccaagctatcaaatcttcacagtcatctagatggaagaacctgttgagtttt
cattgtcgtaatagattactattaacgggtactcctatccaaaacagtatgcaggaacta
tgggcacttttacattttatcatgccttctctttttgattctcacgatgaatttaatgaa
tggttctctaaggatattgaatctcatgcagaagctaataccaaattaaaccaacagcaa
ttacgtcgtttgcatatgattttgaaaccgttcatgttaaggcgtgtcaaaaagaacgtc
caatcagaattgggcgacaagattgaaattgatgtcttatgtgatttaactcaaaggcag
gctaaattatatcaggttttgaaatctcaaatctctactaactatgatgccattgagaat
gccgctacgaatgattctacttccaattctgcttcaaattctggttctgatcagaacttg
attaacgcagtcatgcaattcaggaaagtttgtaaccacccggatctttttgaaagggca
gatgtagattctccattttccttcactacttttggtaaaactacctcgatgttaactgca
tctgttgctaataacaacagcagcgtaattagcaacagtaatatgaatctctctagcatg
agcagtaataatatttccaatgggaaattcactgatttgatttactcttcaaggaatcca
ataaaatatagcctaccaaggttgatttatgaagatttgattttaccgaattacaacaat
gacgtggacatagccaataaactgaagaacgtgaaatttaatattttcaacccatcaact
aattatgaactgtgcttatttttatctaaattaacaggtgaaccctcgttgaatgaattt
tttagagtttctactacacccttactcaagcgagtaatagaacgtacaaatggtccaaaa
aatactgacagtttaagttttaaaaccattactcaagagctactcgaggttactagaaat
gcaccttccgagggcgtaatggcttcattattgaacgttgaaaaacatgcctatgaacgt
gagtatctgaactgtatacaacgtggttatcatcccaatgtttcagctcctccggtcacc
attgaagttcttggttctagtcatgttaccaatagcataaataatgaactgtttgacccg
ttgataagtcaggcattatccgatattccagcaataacgcaatataacatgcacgttaaa
aagggaatacctgttgaagattttccaaagacaggactattccctgaaccactaaataaa
aatttttcatccaacatatcaatgccatctatggataggttcattaccgaatcagcgaaa
ttaagaaaattggatgaattgttggtaaagttgaaatcagaaggccacagagttttgata
tatttccaaatgaccaagatgatggatcttatggaagaatacttgacctatagacaatat
aatcatattagactggatggttcctcaaagttggaggaccgtcgagatttggtccatgat
tggcagactaatccagaaatctttgttttcctcctaagtacaagagcaggtggtctaggt
atcaacctgaccgcagctgacactgttatattctatgattcagattggaaccctactatt
gattcacaggctatggatagggcacataggttgggccaaacgaggcaagtcacagtgtac
agattacttgttcgtggtaccatcgaagaaagaatgagggatagagcaaagcaaaaagag
caagttcaacaagtcgtcatggaaggtaagactcaggaaaaaaacattaaaaccattgaa
gtgggtgaaaatgattccgaagtcactcgtgaaggtagcaaaagcataagtcaagatgga
attaaggaagcggcaagtgcattggcatga

DBGET integrated database retrieval system