KEGG   Saccharomyces cerevisiae (budding yeast): YGL151WHelp
Entry
YGL151W           CDS       T00005                                 

Gene name
NUT1, MED5, SSX4
Definition
(RefSeq) Nut1p
  KO
K15147  mediator of RNA polymerase II transcription subunit 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YGL151W (NUT1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Middle
     YGL151W (NUT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Med5
Motif
Other DBs
NCBI-GeneID: 852726
NCBI-ProteinID: NP_011364
SGD: S000003119
UniProt: P53114
Position
VII:217524..220922
Genome map
AA seq 1132 aa AA seqDB search
MEKESVYNLALKCAERQLTSMEFSNLYKEFFNEKFPSLIQEEEEDTTTTANINEVKKASD
LVDTPSNNTAATADTTHLHEALDIVCSDFVKILNLEKPLILADYIVEVLLVNYNSDMIKC
FLPKLNSVRNSLLLAHFFSKSCSFFAKLSDTLIIDQVRKDLGNVIVPNILSLDMNSMNKE
LIAIVSKLLQTTLKLSPSPILLTSAGCKNGSFTLLNQLSQTNKLLFKRVSQTFEAKLHFK
DTKPFLNKDSTNEFVGSPSLTSPQYIPSPLSSTKPPGSVNSAAKYKDMKLLRYYKNIWLN
NKIINWEISNPDFLSKYSAITSSIFQESFNSVQNLDQLLTDLIETSFTCFAQFVSNKQYH
QANSNLTLLERKWVIFITKHLPLLILENSSRSPRVVTNALDNIDEKVVKAIRIYFTEKDD
NKTNNEDLFDDYPSTSLDIRHDFIKGLIMLNLQPASVINNYLREDQMIDTSILPTRDDLF
VRNLQGIQEVVHNTNSFIISSLDTLELESITESITHDSSNGLFQVLHNFESVAPTKQREI
VKAFLSIFEDAIKELNYNRIAKICALLFFNFSHSLTTILSFSSPAALMKTLIKFVDLSRN
GRNGSNGNDESSEYETINISLSFSWAILLIINLTQTYGISVVDVALKYPELSIKNSFIIN
FISNLPNVSDKYYLEESNVNDSDMLTKSHNTVQSWLCDLFVNGSITDQLIQNIETRQLAN
LIPFIVKQVLLSVEIGVLTDISSLIGGFEYFLQPLLLVGLIKTFYWLEQFLSCVKNDTIS
EDILQGIFNLLNTLFNPVTLNEDSKAFHTAVLRLNAIPLLKVLRKFRVQSQSNYGIYSSD
AQGDPNLEPLIAKLVAVLNVSPVYDVDPRIINSENDYSRKQLGYGKFLILNENPINKIMT
NQINSFWSLHSSTYYNLDYLFELIELVTPKSFLFDVLKTLEYKLATYGVPGSENKRGSLD
SEHVFDYFFYFLVLYDVKTAEEASQLIEYMENDAKKSKGDVDIKGEDLHEKNDSAEVRQE
TQPKAEATQDDDFDMLFGENDTSTQAYEEEEENEDNDGNNRTNNVPMIKAEETPSKTNKI
SILKRHSFAVLLHERKLLNDLALENGEITKTENEKFISYHDKYLCMLKTCVF
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaatcagtatacaacttagcactaaaatgtgctgagcggcaattgacctcc
atggaattttcgaacctttacaaggaattctttaatgaaaagttcccgtctttgattcaa
gaggaagaagaagatacaacaacaactgcaaatataaatgaggtcaagaaagcgtccgat
ttggtggatacacccagcaacaacacggctgctactgcagatactacacacttacacgag
gctctagatattgtttgctccgattttgttaaaatattaaacctggagaagcctcttatc
ttggcagattatatcgttgaggtattgcttgtgaactacaactcagatatgataaaatgc
tttctgcctaaattgaattccgttaggaactccttgctattggcccattttttctccaaa
tcttgttcattctttgccaaattatcagatactttgataattgatcaagtacgcaaggat
ttgggcaacgtcatagtaccgaatatcttaagtctagacatgaatagtatgaataaagaa
ttgattgccatagtatcaaagcttttgcaaacaactttaaaactctctccttcaccaatt
cttttaacttctgccggctgtaaaaatgggtcttttacgctactaaatcagttgtctcaa
accaacaagttactttttaaaagggtttctcagacttttgaagcaaaattacatttcaaa
gataccaagccatttttaaacaaagattccactaacgaattcgtaggttctccttcatta
acctcccctcaatatatcccaagtccactttcttcaacaaaacctccaggatcagtcaat
tctgctgccaaatacaaagacatgaagcttcttcgttactataaaaacatttggctgaac
aataaaattatcaattgggaaatatcgaacccagacttcctatcaaaatattctgcgatt
acttcttctatatttcaagagagctttaattcagttcaaaacttggaccagttactcaca
gacttgattgagacatcgtttacttgttttgctcaattcgttagcaataagcaatatcat
caggcaaattctaatttgactctgttagaaagaaagtgggtcatatttataacaaaacat
ctaccattattaatcctggaaaactcttcaagaagtcctcgtgtagtcacgaatgctctg
gataatattgacgaaaaagtcgttaaagcaatcagaatatacttcaccgaaaaagatgat
aacaaaaccaataatgaagatctatttgatgattatccatctacaagcttggatataaga
cacgattttatcaaagggttgattatgttaaatttacagcctgcgtccgttatcaacaat
tacttaagagaggaccaaatgatcgacaccagtattttacctacccgtgatgatttgttt
gttcgtaatttgcaaggcattcaagaagtcgtccataataccaacagtttcatcatttca
tccttagatactttagagttagaatcgataaccgaatcgatcacacatgattcgagtaac
ggactatttcaagtattacacaattttgaatctgtagctccgacaaaacaacgtgagata
gtaaaagcctttttatctatatttgaagatgcaataaaagaattgaattataatagaata
gccaagatatgtgctcttttgtttttcaacttttcacattcattgaccacaattctatca
ttttcttcgccagcagcactaatgaaaacattgataaaattcgttgatttgtctagaaat
ggcagaaatggctcaaacggtaatgatgaaagttcagaatatgaaacgataaatatatct
ttgtcattttcttgggcaattttactgataatcaacctaacacaaacatatggcatatct
gtggtggatgtggcacttaagtatcctgaattgagcataaaaaattcctttataatcaat
ttcatttcaaatctacctaatgtctcagataagtactatttggaagaatcaaatgtgaat
gattcagatatgctaacaaagtctcataataccgttcaaagctggctttgtgatcttttt
gttaatgggtccataacagatcaattgatccaaaatattgaaacaaggcaattggctaat
ctcataccatttattgttaaacaggttttgctatctgttgaaataggcgttttaacggat
atttcaagtctgataggtggcttcgaatatttcttacaacctttactattagttgggcta
atcaaaactttttattggctagaacaatttctttcttgcgtcaagaacgacacaatatct
gaagatattttacaagggatattcaatttattgaatacacttttcaacccagtaactctt
aacgaggattcgaaagcgttccacacggctgtactgaggttgaatgcaattccactactc
aaagttctccgcaaatttagagttcagagccagtcaaattatggtatctactcttctgat
gcccaaggtgatcctaacttagaacctttgatagccaaattagttgccgttcttaatgta
tcacccgtttatgacgtcgatccaagaattatcaattcagagaacgattattctagaaag
cagttgggttacggtaaattcctaattttgaacgaaaacccgattaacaagataatgacg
aaccaaattaactcattctggagtctccacagcagcacatattataacttagattatcta
tttgagttaattgaattggttaccccaaaaagtttcctttttgatgttttgaaaacatta
gaatataaactagccacttatggggtccctggttctgaaaataagaggggatcattggat
tcagagcatgttttcgattatttcttctactttcttgtactatatgatgtgaaaaccgcg
gaggaagccagtcaactaatagaatatatggagaacgacgcaaaaaaaagtaagggggac
gttgatataaagggagaagacttacatgagaaaaatgactcagctgaggtgaggcaagaa
actcaaccaaaagctgaagctacccaagacgatgatttcgatatgctttttggcgagaat
gatacaagcactcaagcttacgaagaagaagaagagaatgaggataacgacggcaataat
agaacaaacaatgtaccaatgataaaagcagaagaaactcctagtaaaactaataagata
tccattttaaagagacattcgtttgcggtacttctgcatgaaagaaaattattgaatgat
ttagctttggaaaacggcgaaataaccaagacagaaaatgagaaatttatcagttatcac
gataagtacttgtgtatgctgaaaacatgcgtattctga

DBGET integrated database retrieval system