KEGG   Saccharomyces cerevisiae (budding yeast): YGL153WHelp
Entry
YGL153W           CDS       T00005                                 

Gene name
PEX14
Definition
(RefSeq) Pex14p
  KO
K13343  peroxin-14
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YGL153W (PEX14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YGL153W (PEX14)
Membrane trafficking [BR:sce04131]
 Autophagy
  Pexophagy
   Selective cargos
    YGL153W (PEX14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pex14_N HAP1_N zf-C4H2 YkuI_C ECH_2 HalX FlgN Fez1 V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 852724
NCBI-ProteinID: NP_011362
SGD: S000003121
UniProt: P53112
Position
VII:216273..217298
Genome map
AA seq 341 aa AA seqDB search
MSDVVSKDRKALFDSAVSFLKDESIKDAPLLKKIEFLKSKGLTEKEIEIAMKEPKKDGIV
GDEVSKKIGSTENRASQDMYLYEAMPPTLPHRDWKDYFVMATATAGLLYGAYEVTRRYVI
PNILPEAKSKLEGDKKEIDDQFSKIDTVLNAIEAEQAEFRKKESETLKELSDTIAELKQA
LVQTTRSREKIEDEFRIVKLEVVNMQNTIDKFVSDNDGMQELNNIQKEMESLKSLMNNRM
ESGNAQDNRLFSISPNGIPGIDTIPSASEILAKMGMQEESDKEKENGSDANKDDNAVPAW
KKAREQTIDSNASIPEWQKNTAANEISVPDWQNGQVEDSIP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtggtcagtaaagatcgtaaggcattgttcgactcagcagtatccttttta
aaggatgagtccattaaagatgctccacttttaaagaaaatcgaatttttaaaatccaaa
gggttaacagaaaaggagattgaaatagccatgaaagagcccaagaaagacggtatcgta
ggcgatgaagtatcgaaaaaaattggtagtactgagaatagagcctcacaggatatgtat
ctctatgaagcgatgccaccaacgctgccccacagggattggaaggactattttgtgatg
gctactgccacagctgggctgttgtatggtgcatatgaagtaactagaaggtatgtgata
ccaaatattttaccagaagcaaaaagcaagttggaaggggacaaaaaagaaattgatgat
cagttctccaaaatcgatacagtcctcaatgccatcgaagcggagcaagctgagtttagg
aaaaaggaaagcgaaacattaaaggaacttagtgacacgattgctgaactgaaacaggcg
cttgtgcagacaacaagaagcagggaaaagatcgaagacgagtttagaatagttaaactc
gaggtggtcaatatgcaaaatacgatcgacaaatttgtttcagataatgacggcatgcaa
gagttaaataatatccaaaaagaaatggaatctctgaaaagcttaatgaataaccgtatg
gaatccggtaatgcgcaggacaacagattattttccatatctcctaatggtatacctggc
atagatacgattccatctgcgtctgagattcttgccaaaatgggcatgcaagaagaaagt
gataaagaaaaggaaaacggcagcgatgctaataaagatgacaatgctgttccagcgtgg
aaaaaagcaagagaacaaactattgatagcaacgcctccattccagaatggcaaaaaaat
accgccgccaatgagatcagtgtccctgactggcaaaatggacaggtcgaagactccatc
ccatag

DBGET integrated database retrieval system