KEGG   Saccharomyces cerevisiae (budding yeast): YGL156WHelp
Entry
YGL156W           CDS       T00005                                 

Gene name
AMS1
Definition
(RefSeq) alpha-mannosidase
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YGL156W (AMS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YGL156W (AMS1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     YGL156W (AMS1)
Membrane trafficking [BR:sce04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    YGL156W (AMS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Motif
Other DBs
NCBI-GeneID: 852721
NCBI-ProteinID: NP_011359
SGD: S000003124
UniProt: P22855
Structure
PDB: 

Position
VII:210416..213667
Genome map
AA seq 1083 aa AA seqDB search
MSSEDIIYDPQFKPVQGIYENRLRQFIDTGGDYHDLNLPKFYDKKRISLDHDHVKVWWYQ
VSFERGSSPVSPDKRPSWKSIIERDKKGELEFREANINQPFGPSWSTTWFKVKISLPEDW
VKSNEQLLFQWDCSNEGIVIDPKTLIPVTAFSGGERTEYVLPKTSDGKHFFYIEAGNNGM
FGCGAGSTINPPDDNRFFHLRKADIVWPDLDARALYIDFWMLGDAARELPGDSWQKHQAR
QLGNAVMNLFDPNDRSSVRKCRELLQREYFDSFLESSKVYEQGESQVLTNVYGIGNCHID
TAWLWPFAETRRKIVRSWSSQCTLMDRFPEYKFVASQAQQFKWLLEDHPEFFNKVLIPKI
QQSQFFAVGGTWVENDTNIPSGESLARQFFFGQRFFLKHFGLKSKIFWLPDTFGYSSQMP
QLCRLSGIDKFLTQKLSWNNINSFPHSTFNWAGIDGSQLLTHMPPGNTYTADSHFGDVLR
TAKQNKTPEYYGSGLMLYGKGDGGGGPTEEMLQKMRRIRSMNNRNGNVIPKLQVGITVDE
FYDDILKRTNQGHDLPTWSGELYFEFHRGTYTSQAQTKKLMRLSEIKLHDLEWIAAKTSV
LYPDSYKYPSKQINELWENVLLCQFHDVLPGSCIEMVYKYEAVPMLHNVVKECTSLIDKT
VQFLQSQSKADLVEMRTLTWSKPEKVSEECSLNGSYTSSVTGYDDYIVLANGKLKVIICK
KTGVITSITDETLGVEYLDTEHGRNKLGANQFVIYDDKPLGWQAWDTELYSVNQYKYVTK
PKKVQVSCNTKEKCAVEVIFQISEKCKIKSVISLNATAVTDAKLSKVDISTTVENWDARN
KFLKVEFPVNIRNDFASYETQFGITKRPTHYNTSWDVAKFEVCHHKFADYSEYSKGVSIL
NDCKYGFSTHGNLMRLSLLRSPKAPDAHADMGTHEIKYAIYPHRGALSSDTVKLAHEFNY
CFKYKLPKDIGMNFDDIISISGDENVILSNIKRGEDDSAVKSNYSLNPRDEQSIVVRVYE
SLGGESFASLNTTLNLKRIEKVDNLEMKVYKSLTATRDESNHAINRIPIKLRPFEIASFR
LYF
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgaggatatcatttatgatcctcagttcaaacctgttcagggaatctacgag
aatagattaagacaatttattgatactggtggggattaccatgacttaaatttacccaag
ttttatgataagaagcgcatttcattagatcatgatcacgttaaggtttggtggtaccag
gtttcttttgaacgtggatcttcccctgtttcccctgataagaggccatcttggaaatct
attattgaacgtgacaagaagggtgaattggagtttagagaagcgaacataaatcagccc
tttggacccagttggtctaccacttggttcaaggtgaaaatctctttgcctgaagattgg
gttaaatcaaacgagcaactacttttccaatgggattgttctaacgaaggaattgtcata
gacccaaagactctaatccctgtgactgctttttcaggtggtgaaaggactgaatatgtt
ttaccgaaaacatcggatgggaaacatttcttttacatcgaagctggtaataatggtatg
tttggctgcggtgcaggatccactataaatccaccagatgataatagattttttcatttg
agaaaagctgatatcgtttggcccgatctagatgctcgtgcattgtatatcgatttttgg
atgctaggggatgctgcaagagagctacctggagactcctggcaaaaacaccaggcaaga
caactaggcaatgcagttatgaatctttttgacccgaatgatcgttcaagtgttcgtaaa
tgtcgtgaattactacaaagggaatactttgactcctttttagaaagcagtaaggtttac
gaacaaggtgaatctcaagttttaacaaatgtttatggtatcggcaactgtcatatagat
acagcttggctatggccattcgcagaaacaagaaggaaaattgtgagatcttggtcttcc
caatgtactttaatggatcgcttcccagagtataaatttgttgcttcacaagcccaacaa
tttaaatggttattagaagatcatcccgaatttttcaataaagtgttaattccaaaaatt
cagcaatctcagttttttgctgttggtggtacatgggttgagaatgataccaatattccc
tcaggggaatcgctggcaaggcaattcttttttggtcaaaggtttttcttgaagcatttt
ggtctcaagtcaaagatattttggttacctgacacctttggttattcttcgcaaatgcca
caactttgccgcttatctggtattgataaatttttgactcaaaagctttcctggaataac
atcaacagttttccgcatagcacgtttaactgggcagggattgacggttctcaattattg
actcacatgcctcctggtaatacgtatacagcagattcacacttcggtgatgttttgcgt
actgccaagcagaataagacaccagaatattacggctccggtttaatgttgtacggaaag
ggtgatggtggtggaggaccaactgaggaaatgctgcaaaaaatgaggcgtattagatcc
atgaataacagaaatggtaatgttattccaaagttacaagttggtataacggttgatgaa
ttttatgatgacattttgaaaaggactaaccaaggccatgatttacccacatggagtggt
gaattgtatttcgaatttcatagggggacatacaccagtcaagctcagaccaaaaaatta
atgaggttgtccgaaattaaactacatgatttggaatggatagctgccaaaacatcagtt
ttatatcccgattcgtataaatacccttccaaacagattaacgaactttgggagaatgtt
ttgttatgtcaatttcacgatgttctaccaggatcatgtattgaaatggtatataagtat
gaggctgtccctatgttgcacaacgttgtgaaagaatgtacttccttaatagacaaaacc
gttcaatttcttcagagtcagagtaaggcagatttggttgagatgagaacattaacttgg
tcaaaaccagaaaaggtttctgaggagtgctcgttgaacggtagttacacgtcctctgta
accgggtacgatgactatatagtccttgccaatgggaagttgaaagttatcatttgcaaa
aagactggggtgatcacaagcattacggatgaaactttgggggtagaatacctggacacg
gaacatggcagaaacaaattgggcgccaaccagtttgttatttatgatgataaacctttg
ggctggcaggcttgggatactgaactttattccgtcaaccaatacaagtatgtaacaaag
ccgaagaaagttcaagtttcctgcaacacaaaagagaaatgtgctgttgaggtcattttt
caaatttccgaaaaatgcaaaatcaaatcagtgatatcactcaatgcaactgcggtcact
gatgctaaattaagtaaagtagacatttctacgacggtagaaaactgggatgctagaaac
aaatttttaaaagttgaatttcccgttaatattcggaacgattttgcttcgtatgaaact
caattcgggattaccaaaagaccaacacattataatacctcatgggacgtcgctaaattt
gaggtttgccatcacaaatttgctgattattctgaatacagcaagggtgtttcaattttg
aacgattgcaaatatgggttttccacacacggtaacttgatgagattatcattattaagg
tcaccaaaggctccggatgcgcatgctgatatgggtactcatgagataaaatatgctatc
tatccacatagaggagcactatcaagcgacactgttaagctcgctcacgaattcaattat
tgcttcaaatacaaactccccaaagatattggcatgaattttgatgacatcataagcatt
tccggagatgagaatgtcattttgtctaacataaaaagaggcgaagatgatagtgctgtc
aagtccaactattcattaaatccaagggatgaacaaagtattgtggtaagggtttacgaa
tctcttggcggggaatcttttgcttcactaaataccacactaaatttgaagcgtattgag
aaggtcgataacttggagatgaaagtttataagagtttgacagcaacgcgagacgaatca
aatcatgcaataaacagaattcccattaaattgagaccttttgagattgcctcattcagg
ttgtatttctga

DBGET integrated database retrieval system