KEGG   Saccharomyces cerevisiae (budding yeast): YGL157WHelp
Entry
YGL157W           CDS       T00005                                 

Gene name
ARI1
Definition
(RefSeq) carbonyl reductase (NADPH-dependent) ARI1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 GDP_Man_Dehyd KR adh_short NAD_binding_10 Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 852720
NCBI-ProteinID: NP_011358
SGD: S000003125
UniProt: P53111
Position
VII:209006..210049
Genome map
AA seq 347 aa AA seqDB search
MTTDTTVFVSGATGFIALHIMNDLLKAGYTVIGSGRSQEKNDGLLKKFNNNPKLSMEIVE
DIAAPNAFDEVFKKHGKEIKIVLHTASPFHFETTNFEKDLLTPAVNGTKSILEAIKKYAA
DTVEKVIVTSSTAALVTPTDMNKGDLVITEESWNKDTWDSCQANAVAAYCGSKKFAEKTA
WEFLKENKSSVKFTLSTINPGFVFGPQMFADSLKHGINTSSGIVSELIHSKVGGEFYNYC
GPFIDVRDVSKAHLVAIEKPECTGQRLVLSEGLFCCQEIVDILNEEFPQLKGKIATGEPA
TGPSFLEKNSCKFDNSKTKKLLGFQFYNLKDCIVDTAAQMLEVQNEA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgactactgataccactgttttcgtttctggcgcaaccggtttcattgctctacacatt
atgaacgatctgttgaaagctggctatacagtcatcggctcaggtagatctcaagaaaaa
aatgatggcttgctcaaaaaatttaataacaatcccaaactatcgatggaaattgtggaa
gatattgctgctccaaacgcctttgatgaagttttcaaaaaacatggtaaggaaattaag
attgtgctacacactgcctccccattccattttgaaactaccaattttgaaaaggattta
ctaacccctgcagtgaacggtacaaaatctatcttggaagcgattaaaaaatatgctgca
gacactgttgaaaaagttattgttacttcgtctactgctgctctggtgacacctacagac
atgaacaaaggagatttggtgatcacggaggagagttggaataaggatacatgggacagt
tgtcaagccaacgccgttgccgcatattgtggctcgaaaaagtttgctgaaaaaactgct
tgggaatttcttaaagaaaacaagtctagtgtcaaattcacactatccactatcaatccg
ggattcgtttttggtcctcaaatgtttgcagattcgctaaaacatggcataaatacctcc
tcagggatcgtatctgagttaattcattccaaggtaggtggagaattttataattactgt
ggcccatttattgacgtgcgtgacgtttctaaagcccacctagttgcaattgaaaaacca
gaatgtaccggccaaagattagtattgagtgaaggtttattctgctgtcaagaaatcgtt
gacatcttgaacgaggaattccctcaattaaagggcaagatagctacaggtgaacctgcg
accggtccaagctttttagaaaaaaactcttgcaagtttgacaattctaagacaaaaaaa
ctactgggattccagttttacaatttaaaggattgcatagttgacaccgcggcgcaaatg
ttagaagttcaaaatgaagcctaa

DBGET integrated database retrieval system