KEGG   Saccharomyces cerevisiae (budding yeast): YGL160WHelp
Entry
YGL160W           CDS       T00005                                 

Gene name
AIM14, YNO1
Definition
(RefSeq) putative metalloreductase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 DUF417
Motif
Other DBs
NCBI-GeneID: 852716
NCBI-ProteinID: NP_011355
SGD: S000003128
UniProt: P53109
Position
VII:200561..202273
Genome map
AA seq 570 aa AA seqDB search
MKESPLITLVKRHSETHFANIKYGYYVLIISLVYLIGLALLRAFGRRTPSRSSSAFKNKI
IYRLYDIDPAIHLGILFFAVLIPFYYHYSLTTQSTVYLKRLGRLSYALIPLNLFLTLRPN
WFLRKNCTYTDFIPFHKWFSRIITVIGLLHGIFFIIKWAIDDNVSLKQKLILKTFNFAGF
IISILVLFLLICSIGPMRRYNYRLFYIVHNLVNVAFILLTPIHSRPGVKFPFLLLNCTLL
FIHIINRIVFAKSLMILNKNANYSKTNLVHVRLPRAILPDYFEPGSHIRISPYRRINPLY
WLLPSHPYTIASLAEDNSIDLIIKETSTAEPGSQIESLRSNPKSFHLDQEKTYTLINSYP
PSVPEECYSQGTNIAIICGGSGISFALPLFRHFFNKENVKYLKMIWLIKDYSEYELVLDY
LKTNGLTFEKKLSNNKRISVFISGEYTAETRLDEITTNIDDENSEYEMGSFNNEDEDLSI
SNFNSENADSNDNTPETSHSPTKENGSMIEVKSKHSFTLSNELKSFNNESAQVNQNETWL
FSCGPPSLLQLSKKYCNDERINFVCETYGL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatcccctctcataacgttggttaaaagacattccgagacacattttgccaat
atcaagtatgggtattatgtgttgataatatcattggtctatctcattggattggctctt
ttgagagctttcggaaggagaaccccatccagatcgtcgtcagctttcaaaaataagata
atttatcggttgtatgatatagatcctgcaattcacttaggtatattgttttttgcagtc
ttgattccattttattaccattactctttgactacccaatctacggtctatctcaaaaga
ttagggaggttgagttacgccttgatcccgctgaacctattcctcactttaaggcctaat
tggttccttaggaaaaattgcacctacactgattttataccgttccataaatggttttca
cgtattatcaccgtgattggtttgcttcatgggattttcttcatcattaagtgggcgata
gacgataatgtctctctaaagcaaaaattgattctgaaaactttcaattttgcgggattc
ataatatcaatattggtactttttttacttatttgctcgattgggccaatgagaagatac
aactatcgtttgttttacatcgtacataacctggtgaacgtggccttcatcttactcacc
ccaatacactctaggccaggtgttaagttcccatttcttctactaaactgtaccctatta
ttcattcatattatcaatagaatagtatttgcgaaatccttgatgattttgaataagaat
gcgaattattcaaaaacaaatttagtccatgtaagattgcccagggctattcttccagat
tattttgaaccagggtcgcatattagaataagcccttacagaagaattaatcccctctat
tggttgctaccatcgcatccatacacaattgcgtctttggcagaagacaattcaattgat
cttattataaaggaaacctctacagccgagccaggtagccagatagagtctcttcgtagt
aatccaaaatcctttcatttagatcaagaaaaaacctatactttgattaatagttatcct
ccctctgtacccgaagaatgttattctcaaggcacgaatatagctattatatgtggtggg
tctggtatatcttttgccctaccactatttaggcatttttttaacaaggagaatgtaaaa
tacttgaaaatgatctggctgataaaagattactctgaatatgaacttgttttggattat
ctcaagacaaatgggttgacttttgagaaaaaactctcgaataataagaggatttcagta
tttattagtggagaatacacggcggaaacacggttagacgaaattacgaccaatatcgac
gatgaaaactcagaatatgaaatgggatctttcaacaatgaagacgaagacctttcgatt
tctaatttcaattcagaaaatgcggacagcaatgacaatacgccagagacaagtcatagc
cccacaaaagagaatggaagcatgatcgaggtaaaatccaaacacagttttactctttcc
aacgaattgaagagcttcaacaatgaaagtgcacaagtgaaccaaaatgaaacatggttg
ttttcatgtggtcctccctcgttattacaattgtctaaaaaatattgtaacgatgaaagg
atcaactttgtctgtgagacttacggattatga

DBGET integrated database retrieval system