KEGG   Saccharomyces cerevisiae (budding yeast): YGL164CHelp
Entry
YGL164C           CDS       T00005                                 

Gene name
YRB30
Definition
(RefSeq) Yrb30p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ran-binding
Motif
Other DBs
NCBI-GeneID: 852712
NCBI-ProteinID: NP_011351
SGD: S000003132
UniProt: P53107
Position
VII:complement(191978..193300)
Genome map
AA seq 440 aa AA seqDB search
MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI
VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI
KAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRKYE
KAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAKARIYR
LNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVSGKLLRLEEQ
DSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVSGYEAIEEDEEEDEEEDEEEGKDGE
ERKEEEEEENKLEDKDSSITLLEYIIRLTSLQSNDQKSILEVSDERLSIYLNDENTNSRK
DRISNSTIEETEKKLKNLKL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaattcttgccaaagcaggttcacaagccgttacatttgctataaaatccgga
atatcgatagcatccacatatgcgctaaagacaataacgaactttgtcgtccagattcct
aaggatgatgctagaagaatagatcaactgaaatttaaactggaaagccgcatggctatt
gtatccagtgcaattgacctaataaagctggtagcggcgaggggaaacacgaatttgcaa
atcactctgaggttaaccaaggatttaaaagaagagattgataggtttgatgagaagatc
aacgaaatgacgcagaaagttgagggttccaggagcgcaaaaacacagaatgaagctatt
aaagcggtagaaaactatataaaggacttgctattgaggatcgaagaaatcactccattc
attaatctttctttaaccacttctggtgccaacttgaacagcgcactcccatatcaactt
tctcctggtttattattaaaagcctccgatttcgttagcgagaacaatagaaagtatgaa
aaggcaatgaagagtaatgagaaaggaacaggtgacaaggagattctaaaagttcaagtg
gggcctacatttgaggttacactattctctattttctataacctaacttcagaaaacaat
gggcaatcaggaattgtttggaaagaggatatgaaacgtgcaaaagcaaggatatataga
ttgaactctacaggcagaaagtatgattattttatgaaaatagaacaagacttcaatgac
ggtagatatcatgaggatgatgacaaagaagacacaccacaggaacttgccatagatctg
aaccatattaagaagctgtttttcagtgtttccggtaagcttctccgattagaagaacag
gattctccagtgttggtattgaagattgaccggagcgatgacaaagaaaatgagagcagt
gaaggagacaagggattactcgatgacattacttggtatgcggtaagcggatatgaagcg
atagaggaagatgaagaggaagatgaagaggaggacgaagaggaaggaaaagacggagaa
gaacgaaaggaagaagaagaagaagaaaataaattggaggacaaggattcgtcgatcaca
ctactggagtacatcattcggctgacgtccttacaaagtaacgatcagaaaagtatattg
gaagtgagtgatgaaaggttatctatatatttgaacgatgaaaatacgaactccagaaag
gatagaataagcaattcgacaattgaagagacagaaaaaaagttaaaaaacctaaaactt
tag

DBGET integrated database retrieval system