KEGG   Saccharomyces cerevisiae (budding yeast): YGL167CHelp
Entry
YGL167C           CDS       T00005                                 

Gene name
PMR1, BSD1, LDB1, SSC1
Definition
(RefSeq) Ca(2+)/Mn(2+)-transporting P-type ATPase PMR1
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YGL167C (PMR1)
Enzymes [BR:sce01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     YGL167C (PMR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 852709
NCBI-ProteinID: NP_011348
SGD: S000003135
UniProt: P13586
Position
VII:complement(187616..190468)
Genome map
AA seq 950 aa AA seqDB search
MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS
SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI
TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG
DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM
GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM
ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE
DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK
RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM
ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI
IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH
KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST
ILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGP
PAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKV
TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF
FQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEEDSTYFSNV
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaatccatttaatgcgagtcttcttgacgaggactcaaaccgtgagagagaa
atactagatgccacagcagaggccctttcgaaaccaagcccttctttagagtattgtact
ttatccgtggacgaagctctagaaaaactggacactgacaaaaacggtggtttacgatca
tctaacgaggccaacaataggagatcactttatggccccaatgaaataaccgtagaagat
gatgaaagtcttttcaagaagttcttgtcaaatttcattgaggatcgaatgattctactt
ttaataggatccgcagtggtctctctttttatgggtaacattgatgatgctgttagtatc
acactggccattttcatagttgtcactgtcggttttgtccaagaatataggtctgaaaaa
tctctagaagcgttgaataaattggttcctgctgaatgtcacttaatgagatgtggtcaa
gagagtcatgtactggcttccaccttggttcctggtgatttagtgcacttcagaataggt
gacagaatccccgcagacattagaattattgaagcaatcgatttatccatcgatgaaagt
aatttaactggtgaaaatgaaccggtacataaaacctcacaaacgatcgaaaaatcttcc
tttaacgatcagcctaattcaattgtaccgatttctgagagatcttgtatagcttatatg
ggtacattagtcaaggaaggtcatggtaagggtatcgtcgtaggaacaggtacaaacaca
tcctttggtgccgtttttgaaatgatgaataatattgaaaaaccgaagactccattgcag
ttaacaatggacaaattgggaaaggacttgtcactggttagcttcatagttattggtatg
atttgtttagttggtatcatacaaggtagatcttggttagaaatgttccaaatatcggta
tccttagcggttgctgctattccagaagggttaccaattattgtcactgttactttggca
ttgggtgttctgagaatggccaagcgtaaagccatcgtgagaaggttaccaagtgtcgaa
actttaggctctgtcaacgttatctgctccgacaaaacaggtacactaacctcaaaccac
atgaccgtatctaaactttggtgcttggacagtatgtccaataagctaaacgtcctctca
ttagacaaaaataagaagactaaaaattctaatggaaatttgaaaaactatttgactgaa
gacgttagggaaactctaactatcggtaatctctgtaataatgcatctttctctcaagaa
catgccatatttctgggaaatcctactgatgtagctcttttagagcaattggcaaacttt
gaaatgcctgatatcagaaacaccgttcaaaaagttcaggaacttccatttaactcgaaa
agaaaattaatggcaaccaagattctcaaccctgtcgacaataagtgtacagtttatgtt
aaaggtgcatttgaaagaattcttgagtactccacaagttatttgaaatcaaagggtaaa
aaaactgaaaagttgactgaagcccaaaaagctacgataaatgagtgcgcaaattctatg
gcatctgaaggtttgcgtgtctttggatttgctaaactaactttgtctgattcatcaact
cctctaaccgaagacctaatcaaagatttaacctttactggtttaatcggtatgaatgac
ccaccaagaccgaacgttaaatttgccatcgaacaattactacaaggtggtgtccatatt
attatgatcactggtgattctgagaataccgcagtaaacattgcaaaacaaattggtatt
ccagttattgatccaaagctttccgttttatccggtgataaattagatgaaatgtcagat
gatcaactggccaatgtcatcgaccacgttaatatttttgctcgtgctacgcctgagcat
aagttaaacattgttcgtgcattaagaaagaggggtgatgtggtagcaatgactggtgat
ggtgttaacgacgctcctgcgttgaaactttcagatattggtgtttctatgggtagaatt
ggtacagatgtagccaaagaagcctcagatatggtcttaactgatgatgacttcagtact
attttaactgccattgaagagggtaaaggtatctttaataatattcagaatttcctgact
tttcaattgtctacttctgttgccgcactatcattagttgcactatctacagcgtttaaa
ctacccaatccactgaacgcaatgcaaattctttggataaatattttaatggatgggcca
ccagctcaatccttaggtgtggaacctgttgatcatgaagttatgaaaaaacctccaaga
aaacgtaccgataaaattttgacccatgatgtaatgaaacgtttactaaccaccgcggcc
tgtatcatcgttgggacagtttacatttttgttaaagagatggccgaagatggtaaagta
actgctagagatactactatgacatttacttgttttgttttttttgatatgtttaatgct
ttggcctgcagacataacacaaagtcaatcttcgaaatcggctttttcacgaacaaaatg
ttcaactacgccgttggactgtctctgttaggtcaaatgtgcgctatatatataccattt
ttccaaagtatctttaaaactgagaaacttggtatctctgatatactattgttattgctc
atcagcagtagcgttttcatcgttgatgaattgagaaaattgtggacgaggaaaaagaat
gaagaagactcaacgtatttctcaaatgtttga

DBGET integrated database retrieval system