KEGG   Saccharomyces cerevisiae (budding yeast): YGL169WHelp
Entry
YGL169W           CDS       T00005                                 

Gene name
SUA5
Definition
(RefSeq) threonylcarbamoyladenylate synthase
  KO
K07566  L-threonylcarbamoyladenylate synthase [EC:2.7.7.87]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YGL169W (SUA5)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YGL169W (SUA5)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.87  L-threonylcarbamoyladenylate synthase
     YGL169W (SUA5)
Ribosome biogenesis [BR:sce03009]
 Prokaryotic Type
  Other maturation factors
   YGL169W (SUA5)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    YGL169W (SUA5)
 Prokaryotic Type
    YGL169W (SUA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC SUA5 TetR_C_4 DUF928
Motif
Other DBs
NCBI-GeneID: 852707
NCBI-ProteinID: NP_011346
SGD: S000003137
UniProt: P32579
Position
VII:186059..187339
Genome map
AA seq 426 aa AA seqDB search
MYLGRHFLAMTSKALFDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIR
DTDETVAFPTETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPH
LSGTSLFDNIPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPV
ARALIALSDTPIAAPSANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGL
CNPPTLLRPGGFTYEEIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVL
LVPHCEGDGILKGVDRMERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDF
SSKTFIIERLGQSGEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAAA
NNCIQF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttggacgacattttttggcaatgacatcgaaagcactgtttgataccaagatc
ttaaaagttaacccgctatcaatcattttctcccctgatgcgcatatagatggttcctta
ccaacgataacagatcctgaaacggaagcagcgctagttgaagcggcgaggataataaga
gatacagatgagactgtggcttttccaaccgaaactgtttatggtcttggaggttctgct
ttaaatgataattcagtgcttagtatatacagggccaaaaataggcctagtgacaatcct
ttgattacacatgtttcatccattgatcaacttaacagaaaggtctttaatcaaccgcat
ctatcaggtacatccttgtttgataacataccctcaatctatcgcccattaatttcaagc
ctttggcctggcccattaacaattcttttgccagttccatcttcagagcatagtgcatta
tcaaagttaacgaccgcagatcagcctacgtttgcggtacgcatacccgctaatccagtg
gctagagcactgattgccctgagcgatacaccaatagctgctccttcagcgaatgcgtct
actaggccatctcctactttagcgtctcatgtttatcatgatctaaaggataaaattccc
ataattcttgatggcggagcgtgcaaggttggtgtagaaagtactgttgttgatgggtta
tgtaatcctcctacgctactgcgacctggcggttttacatatgaagaaattgttaaattg
ggtggtgaagcttggtctctttgtaaagttgagaataagaaaacagttgaaaagggcgaa
aaggtaagaacgcctggtatgaagtatagacactattccccttcagctaaagttgtttta
ctagttcctcattgcgaaggcgatggcattcttaagggcgttgataggatggaaagatta
aagaggttaatcgaaacggaattaaaagccaacagtaatataaaaaaaattgcgatttta
acttccctaaaattacgtgattccgacttacaatctaagatctttaatgaacccgatttt
tcttcgaaaactttcatcatcgaaagacttggccaatctggtgaagaaatacagactaac
ttgtttgcagctttaagaaaagtggatgaaaatgataaagtagacctaatatttgtcgaa
ggtataaatgaggaaggagaaggattagctgttatgaacagattgcgaaaggcggctgca
aataattgtatacagttttaa

DBGET integrated database retrieval system