KEGG   Saccharomyces cerevisiae (budding yeast): YGL180W
Entry
YGL180W           CDS       T00005                                 

Gene name
ATG1, APG1, AUT3, CVT10
Definition
(RefSeq) serine/threonine protein kinase ATG1
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04136  Autophagy - other
sce04138  Autophagy - yeast
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YGL180W (ATG1)
   04136 Autophagy - other
    YGL180W (ATG1)
   04139 Mitophagy - yeast
    YGL180W (ATG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YGL180W (ATG1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YGL180W (ATG1)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YGL180W (ATG1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YGL180W (ATG1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   YGL180W (ATG1)
Membrane trafficking [BR:sce04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    YGL180W (ATG1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    YGL180W (ATG1)
SSDB
Motif
Pfam: DUF3543 Pkinase PK_Tyr_Ser-Thr APH
Other DBs
NCBI-GeneID: 852695
NCBI-ProteinID: NP_011335
SGD: S000003148
UniProt: P53104
Position
VII:160065..162758
AA seq 897 aa
MGDIKNKDHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAK
LKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKEL
MENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLL
STPLIGYHDSKSFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILN
YQKYNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKE
LICSLLTFDPAQRIGFEEFFANKVVNEDLSSYELEDDLPELESKSKGIVESNMFVSEYLS
KQPKSPNSNLAGHQSMADNPAELSDALKNSNILTAPAVKTDHTQAVDKKASNNKYHNSLV
SDRSFEREYVVVEKKSVEVNSLADEVAQAGFNPNPIKHPTSTQNQNVLLNEQFSPNNQQY
FQNQGENPRLLRATSSSSGGSDGSRRPSLVDRRLSISSLNPSNALSRALGIASTRLFGGA
NQQQQQQQITSSPPYSQTLLNSQLFHELTENIILRIDHLQHPETLKLDNTNIVSILESLA
AKAFVVYSYAEVKFSQIVPLSTTLKGMANFENRRSMDSNAIAEEQDSDDAEEEDETLKKY
KEDCLSTKTFGKGRTLSATSQLSATFNKLPRSEMILLCNEAIVLYMKALSILSKSMQVTS
NWWYESQEKSCSLRVNVLVQWLREKFNECLEKADFLRLKINDLRFKHASEVAENQTLEEK
GSSEEPVYLEKLLYDRALEISKMAAHMELKGENLYNCELAYATSLWMLETSLDDDDFTNA
YGDYPFKTNIHLKSNDVEDKEKYHSVLDENDRIIIRKYIDSIANRLKILRQKMNHQN
NT seq 2694 nt   +upstreamnt  +downstreamnt
atgggagacattaaaaataaagatcacacaacctctgtgaaccataatctaatggcaagt
gcaggaaattacaccgctgagaaagaaatcggaaagggttcgtttgccactgtatataga
gggcatctgacatccgacaaatctcagcatgtagccataaaggaagtatcaagggcgaaa
ttaaaaaataagaaattactagagaatttggaaatagaaatcgctatcttgaagaaaatc
aagcatcctcatatcgtcggacttattgactgtgaacgaacatcaacagatttttatttg
atcatggagtactgtgctcttggggacctaacatttctgttgaaaaggcgtaaagaattg
atggagaatcatcctctactaaggaccgtatttgaaaaataccctccaccgagtgagaac
cataacggcctgcatagagcgtttgtcttgagttatttacagcagttagcgtccgctttg
aaatttttgaggtctaaaaacttggttcatagagacatcaagcctcaaaacttactatta
tctacacccctaattggatatcatgattcaaaaagcttccatgaacttggatttgttggg
atctacaacttacccattttaaagatagcagatttcgggtttgcaagatttttgccaaac
acgtcattagcagaaactctttgtggctcaccattatatatggcaccagaaattttgaat
tatcaaaaatataacgctaaagcagatctgtggtctgtcggtacagtggtattcgaaatg
tgctgtggcaccccaccgtttagagcttccaatcatttggagttattcaagaaaattaaa
agagcaaacgatgtcataacgtttccttcatattgcaatattgaaccagagttaaaagag
ttgatatgtagtttattgacatttgatccagcccaaagaataggatttgaggagtttttt
gctaacaaggtagtcaacgaagacttgtcttcttatgaattggaagatgatttacctgag
ttagaatccaaatcaaaaggtattgtagaaagtaatatgttcgtttctgagtatttatct
aaacagccaaagagtccgaacagtaatcttgcaggtcatcaatcaatggcagataatccc
gcggagctcagtgatgccctcaagaacagcaatatattaactgccccagccgttaaaaca
gaccatacacaagccgtagataaaaaggcttcaaataataaataccataatagcctagtt
tcagatagaagctttgaaagagaatatgtggtggtagagaagaaatcggttgaagttaat
tcattggcagacgaggttgctcaagcaggattcaatccaaatcctattaagcacccaact
tcaactcaaaatcagaacgtcttattgaatgagcaattctctccaaacaatcaacagtat
tttcaaaatcaaggagaaaatccgaggttactgagggccacatcatcttccagtggaggt
agtgatgggtctaggcgaccatctttggtggatagacgcttgtctatatcctcgctgaat
ccatctaatgcattatcaagagccctcggtattgcatcaacgagattgtttggtggtgca
aatcaacagcagcaacagcaacaaatcacatcttccccaccgtacagtcaaactttgttg
aattcccaactttttcatgaacttactgagaatataatattaagaatagatcacctacag
catccagagacactgaaattagataatactaatatcgttagtattttggaatctctggcc
gcaaaggcatttgttgtttactcttatgcagaagtgaaattttctcaaattgttccatta
tcaacaacattaaaaggcatggctaactttgagaacaggcgcagtatggatagtaatgct
attgcagaagaacaagactcagacgatgcagaagaagaggatgaaacgttgaaaaagtac
aaggaagattgcttatccacgaaaacttttggaaagggtagaactttatctgccacatct
cagttgagtgcaactttcaataaactaccacgttcggaaatgatccttctatgtaatgag
gccattgtcttatatatgaaggcattatccattttatcaaaatctatgcaggtaacgtcc
aactggtggtatgaatctcaagaaaaatcatgttctctaagagttaacgtgttggtacag
tggctaagggaaaaatttaatgaatgtttagaaaaagctgatttcctgagattaaaaatt
aacgacttgagattcaagcatgcttctgaggtagctgaaaatcaaactttggaagaaaaa
ggtagttcggaagagccagtatatttagaaaagctattatatgatcgtgcattagaaata
tctaagatggccgcacatatggaattaaaaggagaaaatttgtacaactgtgaattagct
tatgcaacttcactttggatgttagaaacttctctggacgatgatgattttacgaatgcc
tatggtgactacccttttaaaactaacatacatctaaaaagtaacgacgttgaagataaa
gagaagtatcatagtgtgttggatgaaaatgacagaataatcataagaaagtatattgat
agtattgcaaacaggttgaaaatattgaggcagaagatgaaccaccaaaattaa

DBGET integrated database retrieval system