KEGG   Saccharomyces cerevisiae (budding yeast): YGL185CHelp
Entry
YGL185C           CDS       T00005                                 

Definition
(RefSeq) putative hydroxyacid dehydrogenase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ApbA
Motif
Other DBs
NCBI-GeneID: 852690
NCBI-ProteinID: NP_011330
SGD: S000003153
UniProt: P53100
Position
VII:complement(153167..154306)
Genome map
AA seq 379 aa AA seqDB search
MCDSPATTGKPTILFIADPCETSATLNSKAFKEKFRILRYQLDTKEAFLNFLERHEQDKI
CAIYAGFPAFKKIGGMTRSIIEHKSFPRKNLKCIVLCSRGYDGWDLDTLRKHEIRLYNYQ
DDENEKLIDDLKLHQVGNDVADCALWHILEGFRKFSYYQKLSRETGNTLTARAKAAEKSG
FAFGHELGNMFAESPRGKKCLILGLGSIGKQVAYKLQYGLGMEIHYCKRSEDCTMSQNES
WKFHLLDETIYAKLYQFHAIVVTLPGTPQTEHLINRKFLEHCNPGLILVNLGRGKILDLR
AVSDALVTGRINHLGLDVFNKEPEIDEKIRSSDRLTSITPHLGSATKDVFEQSCELALTR
ILRVVSGEAASDEHFSRVV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgattctcctgcaacgactggaaagcctactattcttttcatcgcagatccgtgc
gaaacatcagccacacttaattccaaggcattcaaagagaagttcaggatcttgcgctat
cagctggacaccaaagaagcatttcttaactttttagaaaggcatgaacaagacaaaata
tgtgccatttatgctgggtttccggcattcaaaaaaatcggtgggatgactcgaagtatc
atcgaacacaagtcatttccaaggaaaaatttaaaatgtatcgtgctttgctcaagaggt
tacgacggatgggatctggatacattacgcaagcatgaaattcgattatacaactaccaa
gacgatgaaaatgaaaaattgatagacgatttaaagcttcatcaagtcggtaatgatgtg
gcagattgtgccttgtggcacattctggagggctttagaaagttctcctattaccaaaaa
cttagtagagaaactggaaatacattaactgcaagggcgaaagctgcagaaaagagcgga
tttgcttttggccatgaactggggaatatgtttgctgaatcaccaagaggaaagaaatgc
ttaattcttggtttaggaagtattggaaagcaagtagcctacaagttgcaatacgggcta
ggaatggaaatacattattgcaaaagaagcgaagattgcacaatgagtcaaaacgaaagc
tggaaatttcatttgctagatgaaacaatatatgcaaaactataccagtttcatgcaatc
gtggtcacattgccgggaactccacaaacagaacatttaatcaacaggaaatttttggaa
cactgcaatccaggcctaattttagtcaacttgggaagaggtaaaattttggacttgcgg
gctgtttctgacgccttggtaacgggacgaatcaaccatctcggtttagacgtctttaat
aaagaaccagaaatagatgaaaaaatcagatcttctgatagacttacttcaattactccg
catttgggtagtgcgacaaaggatgtttttgagcaaagttgtgaactggcattgacaaga
atcttacgggtagtgtctggggaagccgcaagcgatgagcatttctcccgtgtagtttga

DBGET integrated database retrieval system