KEGG   Saccharomyces cerevisiae (budding yeast): YGL202WHelp
Entry
YGL202W           CDS       T00005                                 

Gene name
ARO8
Definition
(RefSeq) bifunctional 2-aminoadipate transaminase/aromatic-amino-acid:2-oxoglutarate transaminase
  KO
K00838  aromatic amino acid aminotransferase I / 2-aminoadipate transaminase [EC:2.6.1.57 2.6.1.39 2.6.1.27 2.6.1.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00130  Ubiquinone and other terpenoid-quinone biosynthesis
sce00270  Cysteine and methionine metabolism
sce00300  Lysine biosynthesis
sce00350  Tyrosine metabolism
sce00360  Phenylalanine metabolism
sce00380  Tryptophan metabolism
sce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01210  2-Oxocarboxylic acid metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
sce_M00030  Lysine biosynthesis, AAA pathway, 2-oxoglutarate => 2-aminoadipate => lysine
sce_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YGL202W (ARO8)
   00300 Lysine biosynthesis
    YGL202W (ARO8)
   00350 Tyrosine metabolism
    YGL202W (ARO8)
   00360 Phenylalanine metabolism
    YGL202W (ARO8)
   00380 Tryptophan metabolism
    YGL202W (ARO8)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YGL202W (ARO8)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    YGL202W (ARO8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sce01007]
    YGL202W (ARO8)
Enzymes [BR:sce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     YGL202W (ARO8)
    2.6.1.27  tryptophan transaminase
     YGL202W (ARO8)
    2.6.1.39  2-aminoadipate transaminase
     YGL202W (ARO8)
    2.6.1.57  aromatic-amino-acid transaminase
     YGL202W (ARO8)
Amino acid related enzymes [BR:sce01007]
 Aminotransferase (transaminase)
  Class I
   YGL202W (ARO8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 852672
NCBI-ProteinID: NP_011313
SGD: S000003170
UniProt: P53090
Structure
PDB: 

Position
VII:116059..117561
Genome map
AA seq 500 aa AA seqDB search
MTLPESKDFSYLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLKDYFPWDNLSVDSP
KPPFPQGIGAPIDEQNCIKYTVNKDYADKSANPSNDIPLSRALQYGFSAGQPELLNFIRD
HTKIIHDLKYKDWDVLATAGNTNAWESTLRVFCNRGDVILVEAHSFSSSLASAEAQGVIT
FPVPIDADGIIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQK
YDFLIVEDEPYYFLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTEGRVIRM
DSFSKVLAPGTRLGWITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLSRWGQKGYLDW
LLGLRHEYTLKRDCAIDALYKYLPQSDAFVINPPIAGMFFTVNIDASVHPEFKTKYNSDP
YQLEQSLYHKVVERGVLVVPGSWFKSEGETEPPQPAESKEVSNPNIIFFRGTYAAVSPEK
LTEGLKRLGDTLYEEFGISK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactttacctgaatcaaaagacttttcttacttgttttcggatgaaaccaatgctcgt
aaaccatccccattgaaaacctgcatccatcttttccaagatcctaacattatctttttg
ggtggtggcctgccattaaaagattatttcccatgggataatctatctgtagattcaccc
aagcctccttttccccagggtattggagctccaattgacgagcagaattgcataaaatac
accgtcaacaaagattacgctgataaaagtgccaatccttccaacgatattcctttgtca
agagctttgcaatacgggttcagtgctggtcaacctgaactattaaacttcattagagat
cataccaagattatccacgatttgaagtataaggactgggacgttttagccactgcaggt
aacacaaatgcctgggaatctactttaagagtcttttgtaaccgaggtgatgtcatctta
gttgaggcacattctttttcctcttcattggcttctgcagaggctcaaggtgtcattacc
ttccccgtgccaattgacgctgatggtatcattcctgaaaaattagctaaagtcatggaa
aactggacacctggtgctcctaaaccaaagttgttatacactattccaacgggccaaaat
ccaactggtacttccattgcagaccatagaaaggaggcaatttacaagatcgctcaaaag
tacgacttcctaattgtggaagatgaaccttattatttcttacaaatgaatccctacatc
aaagacttgaaggaaagagagaaggcacaaagttctccaaagcaggaccatgacgaattt
ttgaagtccttggcaaacactttcctttccttggatacagaaggccgtgttattagaatg
gattccttttcaaaagttttggccccagggacaagattgggttggattactggttcatcc
aaaatcttgaagccttacttgagtttgcatgaaatgacgattcaagccccagcaggtttt
acacaagttttggtcaacgctacgctatccaggtggggtcaaaagggttacttggactgg
ttgcttggcctgcgtcatgaatacactttgaaacgtgactgtgccatcgatgccctttac
aagtatctaccacaatctgatgctttcgtgatcaatcctccaattgcaggtatgtttttc
accgtgaacattgacgcatctgtccaccctgagtttaaaacaaaatacaactcagaccct
taccagctagaacagagtctttaccacaaagtggttgaacgtggtgttttagtggttccc
ggttcttggttcaagagtgagggtgagacggaacctcctcaacccgctgaatctaaagaa
gtcagtaatccaaacataattttcttcagaggtacctatgcagctgtctctcctgagaaa
ctgactgaaggtctgaagagattaggtgatactttatacgaagaatttggtatttccaaa
tag

DBGET integrated database retrieval system