KEGG   Saccharomyces cerevisiae (budding yeast): YGL203CHelp
Entry
YGL203C           CDS       T00005                                 

Gene name
KEX1
Definition
(RefSeq) serine-type carboxypeptidase
  KO
K01288  carboxypeptidase D [EC:3.4.16.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sce01002]
    YGL203C (KEX1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.6  carboxypeptidase D
     YGL203C (KEX1)
Peptidases [BR:sce01002]
 Serine Peptidases
  Family S10
   YGL203C (KEX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S10 CDC45 DUF3732 BUD22 LAP1C
Motif
Other DBs
NCBI-GeneID: 852670
NCBI-ProteinID: NP_011312
SGD: S000003171
UniProt: P09620
Structure
PDB: 

Position
VII:complement(112475..114664)
Genome map
AA seq 729 aa AA seqDB search
MFYNRWLGTWLAMSALIRISVSLPSSEEYKVAYELLPGLSEVPDPSNIPQMHAGHIPLRS
EDADEQDSSDLEYFFWKFTNNDSNGNVDRPLIIWLNGGPGCSSMDGALVESGPFRVNSDG
KLYLNEGSWISKGDLLFIDQPTGTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDFLENY
FKIFPEDLTRKIILSGESYAGQYIPFFANAILNHNKFSKIDGDTYDLKALLIGNGWIDPN
TQSLSYLPFAMEKKLIDESNPNFKHLTNAHENCQNLINSASTDEAAHFSYQECENILNLL
LSYTRESSQKGTADCLNMYNFNLKDSYPSCGMNWPKDISFVSKFFSTPGVIDSLHLDSDK
IDHWKECTNSVGTKLSNPISKPSIHLLPGLLESGIEIVLFNGDKDLICNNKGVLDTIDNL
KWGGIKGFSDDAVSFDWIHKSKSTDDSEEFSGYVKYDRNLTFVSVYNASHMVPFDKSLVS
RGIVDIYSNDVMIIDNNGKNVMITTDDDSDQDATTESGDKPKENLEEEEQEAQNEEGKEK
EGNKDKDGDDDNDNDDDDEDDHNSEGDDDDDDDDDEDDNNEKQSNQGLEDSRHKSSEYEQ
EEEEVEEFAEEISMYKHKAVVVTIVTFLIVVLGVYAYDRRVRRKARHTILVDPNNRQHDS
PNKTVSWADDLESGLGAEDDLEQDEQLEGGAPISSTSNKAGSKLKTKKKKKYTSLPNTEI
DESFEMTDF
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgttttacaataggtggctcggaacgtggctagccatgtctgctttaataaggatctca
gtatcccttccgtcatctgaggagtacaaagtggcatatgagctgttgccagggttatct
gaagtgccagacccttcaaatattccacagatgcatgctggccatattcctttacgttcc
gaagatgcggatgaacaggatagctctgacttggagtactttttttggaagtttaccaat
aacgactctaatggcaatgtcgaccgtcccttaattatatggttaaatggtggacccggt
tgctcttccatggatggtgccttggtcgaatccggcccttttagggtgaattcagacggt
aaactttatctaaatgaagggtcctggatatccaaaggcgatcttttatttatcgaccaa
cctactggtactgggttttctgtcgaacaaaataaagacgaaggtaaaatcgacaaaaac
aaatttgacgaagacctagaagatgtgaccaagcattttatggattttctggagaactat
ttcaagatttttccagaagacctcactaggaaaatcatactatcgggtgaaagttacgct
ggccaatacataccattctttgccaatgcaattttgaaccataacaaattttcaaagatc
gacggggatacatacgacttgaaggcgctattgattggtaacggttggattgaccccaat
acacagtccctatcgtaccttccgtttgctatggagaagaaactgattgatgaaagcaac
cccaatttcaaacacttaacgaacgcacacgagaattgccagaatctgataaactctgcc
agtacagatgaggcagcccatttttcgtatcaggaatgtgagaatattttaaaccttcta
ttgtcttataccagggaatcttcgcaaaagggaacagcggattgcttgaacatgtataac
ttcaatttaaaagatagttatccatcttgtggtatgaattggccgaaagatatttccttt
gtcagtaaattcttcagcacacctggtgttattgattcgttgcatcttgattctgataaa
attgatcattggaaggaatgcactaatagcgttggaactaaattgtctaatcctatttca
aagccatctatccatttattacctggtctacttgaaagtggaatagagattgtcttgttc
aatggtgacaaagacttgatttgtaataacaagggcgtattagatactatagacaatcta
aaatggggtggaataaagggatttagcgacgatgctgtttcgttcgattggatccataaa
tcgaagagtacagacgacagcgaagaatttagcggatacgtgaagtatgatagaaatttg
acgtttgttagcgtttataatgcttctcacatggtacccttcgataaaagtttagtgagt
agaggcattgtcgatatttactcgaacgatgttatgatcattgacaacaatgggaaaaat
gttatgattactactgacgacgatagtgatcaagatgctactactgaaagcggtgataag
ccaaaagaaaacctcgaagaggaagaacaggaagcgcagaatgaggaaggaaaggaaaaa
gaaggcaataaagataaagatggcgatgatgataacgacaatgatgacgacgatgaagac
gatcacaactccgagggcgacgacgatgatgacgatgacgatgatgaagacgataataat
gaaaaacaaagtaatcaaggcctcgaggatagtagacataaatcttcagaatatgaacaa
gaagaggaagaggtagaagaatttgcagaagagatttcaatgtataaacacaaagcggta
gtagttaccatcgttacatttttgatagtggttttaggagtttatgcgtatgatagaaga
gtgaggagaaaagcgcgtcacacaattttagttgatccaaataatagacaacatgacagt
cccaataagacagtttcatgggcagatgatctggaaagcggactcggggcagaagatgat
ttagaacaagatgagcagttagaaggcggagcacccataagtagcacttctaacaaagca
ggatctaaattgaaaactaagaaaaagaagaagtatactagccttccgaacactgaaatc
gatgaatcttttgagatgactgatttttaa

DBGET integrated database retrieval system