KEGG   Saccharomyces cerevisiae (budding yeast): YGL207WHelp
Entry
YGL207W           CDS       T00005                                 

Gene name
SPT16, CDC68, SSF1
Definition
(RefSeq) chromatin-remodeling protein SPT16
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPT16 FACT-Spt16_Nlob Peptidase_M24 Rtt106 DUF3800
Motif
Other DBs
NCBI-GeneID: 852665
NCBI-ProteinID: NP_011308
SGD: S000003175
UniProt: P32558
Structure
PDB: 

Position
VII:98969..102076
Genome map
AA seq 1035 aa AA seqDB search
MEELNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEF
PATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDV
IALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNE
QAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSA
LCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSN
ITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNF
TKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTV
QIPLDETEPPRFLTNYTKAKSQISFYFNNEEEDNNKKKSSPATKVPSKPDRNSKILRTKL
RGEARGGAEDAQKEQIRKENQKKLHEKLEKNGLLRFSAADANGPDSEPRQYFKKYESYVR
DSQLPTNIRDLRIHVDWKSQTIILPIYGRPVPFHINSYKNGSKNEEGEYTYLRLNFNSPG
SSGGISKKVEELPYEESADNQFVRSITLRSKDGDRMSETFKQIADLKKEATKREQERKAL
ADVVQQDKLIENKTGRTKRLDQIFVRPNPDTKRVPSTVFIHENGIRFQSPLRTDSRIDIL
FSNIKNLIFQSCKGELIVVIHIHLKNPILMGKKKIQDVQFYREASDMSVDETGGGRRGQS
RFRRYGDEDELEQEQEERRKRAALDKEFKYFADAIAEASNGLLTVENTFRDLGFQGVPNR
SAVFCMPTTDCLVQLIEPPFLVINLEEVEICILERVQFGLKNFDMVFVYKDFNKPVTHIN
TVPIESLDFLKQWLTDMDIPYTVSTINLNWATIMKSLQDDPYQFFLDGGWNFLATGSDDE
ASDESEEEVSEYEASEDDVSDESAFSEDEEGSEVDDDISGDESEDYTGDESEEGEDWDEL
EKKAARADRGANFRD
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctgaatattgattttgacgtatttaagaaaaggattgaattgttgtattcc
aagtacaatgagtttgaaggttctccaaattcgctgctgtttgttttaggttcgtccaac
gctgaaaacccgtaccagaagacgaccatattgcataattggttgctaagttacgaattt
cccgctactttgattgcattagttcccggaaaggttattataattactagttctgccaag
gccaagcatttacaaaaggcaattgatctatttaaagaccctgaaagcaaaattacgctg
gaattgtggcaaagaaacaataaagaaccagaactcaataaaaagttatttgatgacgtt
attgccttaatcaatagcgctggtaaaacagtgggtatccctgaaaaggactcttaccaa
ggtaaatttatgactgagtggaacccagtatgggaagcggctgtgaaggagaacgaattc
aatgtcattgatatttcgctgggtctttctaaagtttgggaagtgaaggatgttaacgaa
caagccttcctgtccgtttcaagtaaggggtcggacaaatttatggaccttttatccaat
gaaatggttcgggcagttgacgaggagttgaaaatcaccaatgccaagttatcagacaaa
attgaaaataaaattgatgatgtgaaatttttgaagcaattgagtcccgatttaagcgca
ttatgcccaccaaactacaaattcaactttgatttattggattggacctattctccaatc
attcagtccgggaaaaagtttgatcttagggtttctgcccgttctaccaatgatcagttg
tacggcaacggttgtattttagcttcatgtggtattcgttacaataattattgttctaat
attactaggacctttttgatcgatccatctgaagaaatggccaacaactacgattttcta
ttaactttgcaaaaagaaattgtaactaacattctgaagcccggccgtacaccaaaagaa
gtttatgaatcagtaatagaatacatcgaaaaaaccaaacctgaactagtgcccaatttc
accaaaaacattggttcattgattggtctcgaatttagagattctaactttatattaaat
gttaagaatgattaccgtaaaatccaacgcggtgactgctttaatatttcgtttggtttc
aataatctgaaagattctcaaagtgctaacaactacgctttacaattagctgatacggtt
caaattcctctcgatgaaacagagcctccacgcttcttaacaaattacaccaaagccaaa
tcccagatatcattttatttcaataatgaagaagaagacaataataaaaagaaatcttca
cctgccaccaaagtccctagtaaaccagacagaaattccaaaattttaagaacaaagtta
cgtggcgaagcccgtggtggtgccgaagacgctcaaaaggagcaaattcgtaaagaaaac
caaaagaagctacacgaaaaattggaaaagaatggattactcagatttagtgctgctgat
gccaatggcccagatagtgaacctcgtcaatacttcaaaaaatatgaatcttatgttcgg
gattcacaactaccaaccaatattcgtgatctaagaattcatgtcgactggaaaagccaa
acaattattctacccatttacggtaggccagtcccatttcatataaattcatataagaat
ggttctaaaaacgaagaaggcgaatatacgtatttacgtttgaactttaattcaccggga
tcttctggtggtatttctaaaaaagtggaggaattgccgtatgaggaatcagcagacaat
caatttgtacgttcgattacactaagatccaaagatggtgaccgcatgagtgaaaccttt
aaacaaattgcagatttgaaaaaagaagccacaaagagagagcaagaacgtaaggcgctt
gctgatgttgttcaacaggacaaattgattgaaaataaaactggaagaacgaaaagactg
gatcaaatttttgtgaggccaaatccagatacaaaacgtgtacctagtactgtctttatc
catgaaaatggtatcagatttcaatccccactaaggactgatagcagaatagacatatta
ttctcaaacattaagaatctaatttttcaatcttgtaaaggtgaattaattgtcgtcatt
catattcatttgaagaatccaattttaatgggtaaaaagaaaatacaagacgtccaattc
tatcgtgaagcttctgatatgtccgtcgatgaaactggaggtggaagacgaggtcaatcc
agattcagaagatatggtgatgaggatgagctggaacaagaacaagaagaaagaagaaaa
cgagctgcgcttgataaagaatttaagtattttgcagacgcaatcgcagaagcatcaaac
ggtttattgacggtggagaatacatttagagatttgggcttccaaggtgtcccaaataga
tcggcagttttctgtatgccaactacagattgtttagttcaattgattgaaccaccattt
ttggtgattaacctagaggaagtcgaaatctgtattttagaaagagttcaatttggtttg
aaaaacttcgacatggtttttgtttataaagatttcaataaacccgtcactcatatcaat
acagttccgatcgaatctttagatttcttgaagcagtggttaacagatatggatattcct
tacactgtctcaacaatcaatttgaattgggcaactattatgaagtcattacaagatgat
ccatatcagtttttcttagatggtggttggaattttctggctactggttcagatgatgaa
gcatctgatgaaagtgaagaagaagttagtgaatatgaggcttcagaagacgacgtaagt
gatgaaagcgcattttctgaagatgaagaaggatcagaggtggatgacgatattagtggt
gatgaaagtgaggactatactggcgacgagagtgaggaaggtgaagactgggatgaatta
gagaaaaaggctgctagggctgataggggtgcaaactttagagattag

DBGET integrated database retrieval system