KEGG   Saccharomyces cerevisiae (budding yeast): YGL208WHelp
Entry
YGL208W           CDS       T00005                                 

Gene name
SIP2, SPM2
Definition
(RefSeq) Sip2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMPK1_CBM AMPKBI
Motif
Other DBs
NCBI-GeneID: 852664
NCBI-ProteinID: NP_011307
SGD: S000003176
UniProt: P34164
Structure
PDB: 

Position
VII:97338..98585
Genome map
AA seq 415 aa AA seqDB search
MGTTTSHPAQKKQTTKKCRAPIMSDVREKPSNAQGCEPQEMDAVSKKVTELSLNKCSDSQ
DAGQPSREGSITKKKSTLLLRDEDEPTMPKLSVMETAVDTDSGSSSTSDDEEGDIIAQTT
EPKQDASPDDDRSGHSSPREEGQQQIRAKEASGGPSEIKSSLMVPVEIRWQQGGSKVYVT
GSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFV
NYIEVRQPEKNPTNEKIRSKEADSMRPPTSDRSSIALQIGKDPDDFGDGYTRFHEDLSPR
PPLEYTTDIPAVFTDPSVMERYYYTLDRQQSNTDTSWLTPPQLPPQLENVILNKYYATQD
QFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIESS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggtactacgacaagtcatccagcccaaaaaaagcaaacaacaaaaaagtgtcgtgca
cctatcatgagtgacgttagagaaaaacccagcaatgctcaaggctgcgaaccgcaagaa
atggatgctgtgagcaagaaagttactgaactgagcttaaataaatgttcagattcccaa
gacgcggggcagccttcaagggagggatctattaccaaaaaaaaatcgacgttattgctg
cgtgatgaggacgagcccactatgccaaagctatctgttatggaaactgctgtggacact
gactctgggtcttcgtctactagcgatgatgaagagggagatattattgcccagacgaca
gagcccaagcaagatgccagtcctgatgatgatcgctcaggccattcttcgcccagagag
gagggacaacagcaaatacgtgccaaagaagcttcgggaggtccaagtgaaatcaagagc
tcattaatggttcccgtggagataaggtggcagcaaggtggttcaaaagtttacgtgaca
ggctcattcaccaaatggaggaaaatgatcggtttgatacctgattctgacaataatggc
tcatttcatgtgaagctaaggctgcttccaggcacacatagattcagatttatagtggat
aatgagcttagagttagtgatttcctgcccacagcaactgatcagatgggaaacttcgtc
aattacatagaagtcaggcaaccagaaaaaaacccaactaacgaaaagataaggtccaag
gaagcagattccatgcgacctcccaccagcgatcgatcctcaattgctctacaaattggt
aaggatccagacgattttggtgacggatatacaaggtttcatgaagatctgtcacccaga
cctccgttggaatatacaacagacattcccgccgtgtttactgacccgtctgtcatggaa
cgatactattataccttggatcgtcagcaaagcaatactgatacgtcatggctgacacca
ccccaattacctcctcagttggagaatgttatcttgaataaatactatgccacgcaagac
cagttcaacgagaacaactcaggcgctctgcccattccgaaccatgtggtgcttaaccac
ttggttactagtagcattaagcacaatacactttgtgtagcctccatcgttcgatataaa
cagaaatatgtcacccagattctttatacgcccatagagtcctcgtaa

DBGET integrated database retrieval system