KEGG   Saccharomyces cerevisiae (budding yeast): YGL209WHelp
Entry
YGL209W           CDS       T00005                                 

Gene name
MIG2, MLZ1
Definition
(RefSeq) Mig2p
  KO
K09467  zinc-finger protein CreA/MIG
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YGL209W (MIG2)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 metabolic regulators in fungi
    YGL209W (MIG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 FOXP-CC zf-H2C2_5 zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 852663
NCBI-ProteinID: NP_011306
SGD: S000003177
UniProt: P53035
Position
VII:95858..97006
Genome map
AA seq 382 aa AA seqDB search
MPKKQTNFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSD
ELKRHMRTHTGQSQRRLKKASVQKQEFLTVSGIPTIASGVMIHQPIPQVLPANMAINVQA
VNGGNIIHAPNAVHPMVIPIMAQPAPIHASAASFQPATSPMPISTYTPVPSQSFTSFQSS
IGSIQSNSDVSSIFSNMNVRVNTPRSVPNSPNDGYLHQQHIPQQYQHQTASPSVAKQQKT
FAHSLASALSTLQKRTPVSAPSTTIESPSSPSDSSHTSASSSAISLPFSNAPSQLAVAKE
LESVYLDSNRYTTKTRRERAKFEIPEEQEEDTNNSSSGSNEEEHESLDHESSKSRKKLSG
VKLPPVRNLLKQIDVFNGPKRV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaaagcaaacgaatttcccagtagataacgaaaacagaccttttagatgtgat
acctgtcaccgtggtttccatcggttagaacataaaaagagacacttgagaacacacact
ggggaaaaacctcatcattgcgcatttcctggttgtgggaaaagtttcagtagaagcgat
gaactgaaaaggcacatgagaacgcatacagggcaatctcaaaggagattgaagaaagct
agcgtacagaaacaggagtttttgacagtaagcggaattcctaccattgcatcgggcgtg
atgatacaccaaccaataccgcaagtcctaccagcaaatatggccataaatgttcaggca
gtaaatggaggtaacattatacacgctcccaatgcggtgcacccaatggtgataccaatc
atggcccaaccagcccccattcatgcctccgctgcatctttccagcctgcaacttctcct
atgccaatttctacatacactccagttccatcgcaatcattcacctctttccagagctct
attggctccatacagtcaaatagtgatgtttcatctatcttctcgaacatgaatgttcgc
gtaaacactccacgctctgtgccaaactctccgaatgatggatatttacaccagcaacat
atcccacagcagtatcagcatcaaactgccagcccttctgttgccaagcagcagaaaact
tttgcacattctcttgcatctgcattatctaccttacaaaaaagaacgcctgtaagtgcc
ccttccaccactatagaatcaccatcctcaccaagtgattccagtcatacctctgcatcc
agcagcgctatctctttgcctttcagcaatgctccttctcagctcgccgtggccaaagaa
cttgagtccgtctatttagattccaatagatacaccaccaagactaggagggaaagagca
aaattcgaaattcctgaagaacaagaagaagataccaataacagcagcagtggtagtaat
gaggaggagcacgagtcgctagatcatgaatctagcaaaagccgaaagaaattgtcaggc
gtaaaattgccgcctgtacgtaacctactgaaacaaattgatgttttcaacggtcccaaa
agagtttaa

DBGET integrated database retrieval system