KEGG   Saccharomyces cerevisiae (budding yeast): YGL210WHelp
Entry
YGL210W           CDS       T00005                                 

Gene name
YPT32
Definition
(RefSeq) Rab family GTPase YPT32
  KO
K07905  Ras-related protein Rab-11B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YGL210W (YPT32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YGL210W (YPT32)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YGL210W (YPT32)
   04031 GTP-binding proteins [BR:sce04031]
    YGL210W (YPT32)
Membrane trafficking [BR:sce04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    YGL210W (YPT32)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YGL210W (YPT32)
  Exosomal proteins of other body fluids (saliva and urine)
   YGL210W (YPT32)
  Exosomal proteins of colorectal cancer cells
   YGL210W (YPT32)
GTP-binding proteins [BR:sce04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    YGL210W (YPT32)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU KAP_NTPase Gtr1_RagA RsgA_GTPase SRPRB AAA_16 AAA_22 ABC_tran FeoB_N AAA_24 Septin PduV-EutP AAA_7 AAA_29
Motif
Other DBs
NCBI-GeneID: 852662
NCBI-ProteinID: NP_011305
SGD: S000003178
UniProt: P51996
Structure
PDB: 

Position
VII:93792..94460
Genome map
AA seq 222 aa AA seqDB search
MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENK
KIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVA
VGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSK
HQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNCC
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaagattacggatacgactacgattatttatttaagatagttcttatcggc
gactccggtgtgggtaaatctaatctgttgtcgagatttacaaccgatgaattcaacatt
gaatccaaatccacgattggcgtggaattcgctacaagaaccattgaagttgaaaacaag
aagataaaagcacagatttgggacacggcaggtcaagaacgttacagggccatcacgtct
gcgtactaccgtggtgctgtaggtgcacttatagtgtatgatataagcaaatcaagttca
tacgaaaattgcaaccactggcttaccgaactgagagagaacgcagatgacaacgtggct
gttgggttgatagggaacaaatcagatctggctcatttaagagcagtaccaaccgatgaa
gcgaaaaatttcgcaatggaaaaccaaatgttatttactgagacaagtgctttaaatagt
gataatgtagataaagcatttagagaactgatcgtagccatcttccaaatggtaagcaaa
catcaagtagacttaagcgggtcgggtaccaacaacatgggctctaatggcgctccaaag
ggtcctaccatcagcttaacaccggcaccaaaggaagacaagaagaaaaaatccagcaac
tgttgttaa

DBGET integrated database retrieval system