KEGG   Saccharomyces cerevisiae (budding yeast): YGL212WHelp
Entry
YGL212W           CDS       T00005                                 

Gene name
VAM7, VPL24, VPS43
Definition
(RefSeq) Vam7p
  KO
K08502  regulator of vacuolar morphogenesis
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04130  SNARE interactions in vesicular transport
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    YGL212W (VAM7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YGL212W (VAM7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YGL212W (VAM7)
Membrane trafficking [BR:sce04131]
 SNARE
  SNAP-25[C] (Qc)
   STX8
    YGL212W (VAM7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PX
Motif
Other DBs
NCBI-GeneID: 852660
NCBI-ProteinID: NP_011303
SGD: S000003180
UniProt: P32912
Structure
PDB: 

Position
VII:91432..92382
Genome map
AA seq 316 aa AA seqDB search
MAANSVGKMSEKLRIKVDDVKINPKYVLYGVSTPNKRLYKRYSEFWKLKTRLERDVGSTI
PYDFPEKPGVLDRRWQRRYDDPEMIDERRIGLERFLNELYNDRFDSRWRDTKIAQDFLQL
SKPNVSQEKSQQHLETADEVGWDEMIRDIKLDLDKESDGTPSVRGALRARTKLHKLRERL
EQDVQKKSLPSTEVTRRAALLRSLLKECDDIGTANIAQDRGRLLGVATSDNSSTTEVQGR
TNNDLQQGQMQMVRDQEQELVALHRIIQAQRGLALEMNEELQTQNELLTALEDDVDNTGR
RLQIANKKARHFNNSA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaattctgtagggaaaatgagtgaaaagttaagaatcaaggtggacgatgtt
aaaatcaaccccaagtatgttttatacggtgttagtacaccaaacaagcgcctttacaaa
aggtattccgagttttggaaactgaagacacgattggagagagatgtaggaagcaccatc
ccatatgacttccctgaaaagcccggtgtattggacaggaggtggcaaagaagatatgat
gatccggaaatgatcgatgaaagacggatcggactagagaggttcctcaatgaattgtat
aacgatcgttttgattctcgatggagagacacaaaaatagcgcaagacttcctgcagttg
tcaaagccaaatgtttctcaagaaaagtcacagcagcatctagaaactgctgacgaagtg
ggatgggatgagatgataagagatattaaattggatttagataaggagagtgatggcaca
cccagcgtgcgtggagcactaagggcacgtacgaagctccacaagttacgagagcgacta
gaacaggatgtgcaaaagaagtctcttccaagcacggaagtgactcgtcgcgccgctcta
ttgaggtccttgctcaaggaatgcgatgacattggtacagcaaacatagctcaggaccgt
ggacgacttctgggggttgccaccagtgacaactcttcaaccacggaagttcaaggaaga
acgaataacgatttgcaacaggggcagatgcaaatggtgcgcgatcaagaacaagagttg
gttgcactgcaccgaattatccaggcacaacgtggattggccttagagatgaacgaggag
ctgcaaacacagaatgagctacttacagcacttgaagatgacgtcgataacactggtagg
aggttacagatagccaacaagaaggctagacattttaacaacagtgcttga

DBGET integrated database retrieval system