KEGG   Saccharomyces cerevisiae (budding yeast): YGL213CHelp
Entry
YGL213C           CDS       T00005                                 

Gene name
SKI8, REC103
Definition
(RefSeq) SKI complex subunit WD repeat protein SKI8
  KO
K12601  superkiller protein 8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Module
sce_M00392  Ski complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YGL213C (SKI8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGL213C (SKI8)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     YGL213C (SKI8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 852659
NCBI-ProteinID: NP_011302
SGD: S000003181
UniProt: Q02793
Structure
PDB: 

Position
VII:complement(90054..91247)
Genome map
AA seq 397 aa AA seqDB search
MSKVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFV
HKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITREDETKKVIFEKLDLLDSDMK
KHSFWALKWGASNDRLLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVE
SPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVK
FSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFN
DSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDV
KFLKKGWRSGMGADLNESLCCVCLDRSIRWFREAGGK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagtgtttattgccacagcaaatgcaggtaaagctcatgacgctgatattttc
tcggtttctgcttgcaattcatttacggtaagttgttcaggtgacggttacttaaaggtg
tgggataataagctgttagataatgaaaatccaaaagataagtcatattctcactttgtc
cataagtccggattgcaccatgtcgatgtcttgcaagctattgagagagatgcatttgaa
ttatgccttgttgctaccacttcattttctggcgatttactcttctatcgtatcactaga
gaagatgagactaaaaaagttatattcgagaaattggatcttctagactcagacatgaaa
aagcattccttttgggcattaaaatggggtgcctcaaatgacagactactttcccatagg
ctggttgctacagacgtcaaagggaccacttacatttggaagtttcacccgtttgcagat
gagtcaaattctttaacactaaattggagccccacgttagaattacaaggcactgtcgaa
tcgcctatgactccaagtcaatttgccacttctgtggatatctctgaacgaggactaatt
gccacaggttttaataatggaacagtacaaatttcagaactatctacattacgcccgttg
tacaattttgaatctcagcattctatgattaataattcgaattccatcagatcggtgaaa
ttttctcctcaaggatccttattagccattgctcacgattcaaattcatttggttgcatc
actctatatgaaactgaatttggtgaaagaataggctccttatccgtaccaacccatagc
tcgcaggcaagtctgggtgaatttgcacattctagctgggtcatgagtctatcgtttaat
gattctggtgaaacattatgcagtgccggatgggatggtaaattgagattttgggatgta
aaaacaaaggaaagaatcactacattgaatatgcattgtgatgatattgaaattgaagag
gatatcttagctgttgatgaacatggagattctttagctgaacctggtgtctttgacgtg
aagtttttgaaaaaaggttggagatctggtatgggagctgatttaaatgaaagtttatgc
tgtgtttgtttagatagaagcatcaggtggtttagagaagctggcggtaaataa

DBGET integrated database retrieval system