KEGG   Saccharomyces cerevisiae (budding yeast): YGR009C
Entry
YGR009C           CDS       T00005                                 

Symbol
SEC9, HSS7
Name
(RefSeq) Sec9p
  KO
K19950  protein transport protein SEC9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YGR009C (SEC9)
Membrane trafficking [BR:sce04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-25
    YGR009C (SEC9)
SSDB
Motif
Pfam: Sharpin_PH
Other DBs
NCBI-GeneID: 852892
NCBI-ProteinID: NP_011523
SGD: S000003241
UniProt: P40357
Structure
PDB: 
3B5N

Position
VII:complement(509047..511002)
AA seq 651 aa
MGLKKFFKIKPPEEATPEQNKDTLMELGISVKNPSKKRKEKFAAYGKFANDKAEDKVYAP
PGYEQYARPQDELEDLNASPLDANANEATAGSNRGSSGTQDLGNGAESNSMQDPYAIEND
DYRYDDDPYARFQANKSNGRGSVNAAPYGDYGGGYNGTSLNSYNNDGPYSNQNTSNSWVN
ANGRNSLNHSNSTLNVGPSRQTRQPPVSTSTNSLSLDQRSPLANPMQEKRNPYADMNSYG
GAYDSNTNRSSGTRQGSSKNANPYASMANDSYSNGNLNRSANPYSSRSVRQPQSQQAPMT
YTPSFIASDEAARNSEVDLNEEPRTGEFDFEEVYADKSAENRAALDEPDLNAVMTNEDSI
DLNASEVDHSSRQQQQQQWFMDEQQQQQQHFNATNNQYGDQRGYKTFEEIQKEEEARQQQ
EEDEAVDEIKQEIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLD
LMKVQNKVADEKVAELKKLNRSILAVHVSNPFNSKRRRREREEQLKNRKIEEKLMREQTS
QQLSQSTQRIEGAMNANNNISEVRERYQRKNVLEKAKRYQFENDEEDDEMELEIDRNLDQ
IQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAGIR
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgggattaaagaaattttttaagattaagcctccagaggaagcgacaccagaacagaac
aaggatactttgatggaactgggtattagtgtcaaaaaccctagcaagaaaagaaaagag
aaatttgccgcctacggtaaatttgcaaatgataaagctgaagataaggtatacgcgcca
ccaggttatgagcagtatgctaggccacaggatgaacttgaggatttgaatgcttctccc
ttagatgccaatgctaacgaggcaactgctggttctaatagaggttcaagtggcacgcaa
gatctcggaaatggagcagaatccaattctatgcaagatccgtacgctatcgaaaatgat
gattaccgatatgatgacgatccttatgcaaggtttcaagctaataaaagtaatgggaga
ggtagcgtcaatgctgcgccttatggtgattatggaggggggtacaatggcacatctctg
aattcatataataacgatggcccgtatagtaaccaaaatacttcaaacagctgggtgaat
gcgaatggccgtaatagtttaaatcattcaaacagcactttaaacgtagggccttcgagg
caaacaaggcaaccgccggtttcaacgtcgaccaacagcttatcgcttgaccaaagaagt
cccttagcaaacccgatgcaagaaaagagaaatccttacgctgatatgaatagttatggc
ggggcgtatgactccaatactaatagatctagcggtactcgacaaggaagctccaagaat
gcaaatccatacgcctctatggcgaacgactcatatagtaatggaaatttgaacaggtct
gcaaatccatattctagtagaagtgtgcgtcaaccgcaatcgcaacaagctccaatgact
tatacgccctcttttattgcttctgatgaagcagcacgcaatagtgaagttgatttaaat
gaagaacctagaacaggtgaatttgattttgaagaagtttatgctgacaagtctgcagaa
aatagagcggcattagatgagcctgatttgaatgcagtaatgacgaatgaagattcaata
gatttaaatgcgtccgaagttgatcatagttcaagacagcagcagcagcaacagtggttc
atggatgagcagcaacagcaacagcaacactttaacgcaacaaataaccaatatggagat
caaaggggttacaaaacatttgaagaaatacaaaaagaagaggaggctcgccagcagcag
gaagaagatgaagcagtagatgaaatcaagcaggagatcaaatttacgaaacagagttcc
gtagcctctactagaaatacactaaaaatggctcaagacgccgaaagagcaggtatgaac
acattgggtatgctgggtcatcaaagtgaacaattgaataacgtagaaggaaacttagat
ttaatgaaggtgcaaaataaagttgcagatgaaaaagttgcagaactaaaaaaattgaac
cgtagtatattggctgtccatgtttctaatccgtttaattccaagagaaggagaagggag
agggaagagcagctgaagaataggaaaattgaagaaaaattaatgagagagcaaacaagt
caacaattgtctcagtccactcaaagaatagagggtgctatgaacgcaaataataacata
agtgaggtgcgggaaagatatcagaggaagaatgttctagaaaaggcaaagagatatcag
tttgagaatgatgaagaagatgacgaaatggaattggaaattgataggaatttggaccag
attcagcaggttagcaacagattgaagaaaatggccttgaccactggtaaagaattagac
tctcagcaaaaacgtctcaacaacattgaggaaagcactgatgatctagatatcaatctc
catatgaataccaacaggttggcaggtatcagatag

DBGET integrated database retrieval system