KEGG   Saccharomyces cerevisiae (budding yeast): YGR010WHelp
Entry
YGR010W           CDS       T00005                                 

Gene name
NMA2
Definition
(RefSeq) nicotinamide-nucleotide adenylyltransferase NMA2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00760  Nicotinate and nicotinamide metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YGR010W (NMA2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     YGR010W (NMA2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     YGR010W (NMA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 852893
NCBI-ProteinID: NP_011524
SGD: S000003242
UniProt: P53204
Position
VII:511545..512732
Genome map
AA seq 395 aa AA seqDB search
MDPTKAPDFKPPQPNEELQPPPDPTHTIPKSGPIVPYVLADYNSSIDAPFNLDIYKTLSS
RKKNANSSNRMDHIPLNTSDFQPLSRDVSSEEESEGQSNGIDATLQDVTMTGNLGVLKSQ
IADLEEVPHTIVRQARTIEDYEFPVHRLTKKLQDPEKLPLIIVACGSFSPITYLHLRMFE
MALDDINEQTRFEVVGGYFSPVSDNYQKRGLAPAYHRVRMCELACERTSSWLMVDAWESL
QSSYTRTAKVLDHFNHEINIKRGGIMTVDGEKMGVKIMLLAGGDLIESMGEPHVWADSDL
HHILGNYGCLIVERTGSDVRSFLLSHDIMYEHRRNILIIKQLIYNDISSTKVRLFIRRGM
SVQYLLPNSVIRYIQEYNLYINQSEPVKQVLDSKE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaccaaagcacccgattttaaaccgccacagccaaatgaagaactacaacca
ccgccagatccaacacatacgataccaaaatctggacccatagttccatatgttttagct
gattataattcttcgatcgatgctcctttcaatctcgacatttacaaaaccctgtcgtca
aggaaaaaaaacgccaactcaagcaaccgaatggaccatattccattaaatactagtgac
ttccagccactatctcgggatgtatcatcggaggaggaaagtgaagggcaatcgaatgga
attgacgctactctacaggatgttacgatgactgggaatttgggggtactgaagagccaa
attgctgatttggaagaagttcctcacacaattgtaagacaagccagaactattgaagat
tacgaatttcctgtacacagattgacgaaaaagttacaagatcctgaaaaactgcctctg
atcatcgttgcttgtggatcattttctcccataacatacctacatttgagaatgtttgaa
atggctttagatgatatcaatgagcaaacgcgttttgaagtggttggtggttatttttct
ccagtaagtgataactatcaaaagcgagggttagccccagcttatcatcgtgtccgcatg
tgcgaattagcatgcgagcggacatcatcttggttaatggttgatgcctgggaatcttta
caatcaagttatacaaggacagcaaaagtcttggaccatttcaatcatgaaataaatatc
aagagaggtggaatcatgactgtagatggtgaaaaaatgggcgtaaaaatcatgttattg
gcaggcggtgatcttatcgaatccatgggcgagcctcatgtgtgggctgattcagacctg
caccatattttgggtaattatggatgtttgatcgtggaaaggactggttctgatgttagg
tccttcttgctttcccatgatatcatgtatgaacacagaagaaatatccttattatcaaa
caacttatttacaatgatatttcctctacgaaagtgcggcttttcatcagacgtggaatg
tcagttcaatatcttcttccaaactctgtcatccgttacatccaagagtataatctatac
attaatcaaagtgaaccggtcaagcaggtcttggatagcaaagagtga

DBGET integrated database retrieval system